KEGG   Trichomonas vaginalis: TVAG_388240Help
Entry
TVAG_388240       CDS       T01022                                 

Definition
(RefSeq) STE family protein kinase
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
tva  Trichomonas vaginalis
Brite
KEGG Orthology (KO) [BR:tva00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tva01001]
    TVAG_388240
   01009 Protein phosphatases and associated proteins [BR:tva01009]
    TVAG_388240
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TVAG_388240
Protein kinases [BR:tva01001]
 Serine/threonine kinases: Other
  Wnk family
   TVAG_388240
Protein phosphatases and associated proteins [BR:tva01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TVAG_388240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 4772487
NCBI-ProteinID: XP_001326717
UniProt: A2DYF9
AA seq 324 aa AA seqDB search
MDPCKRYRRCEFIGSGSYKIVYRAYDQEEGIEVAWNEIRLDKFNEVESNQIKQEISILHQ
LDHPSILKIFSAWRDLSRNSMIFITEFFSNGTIRAYVSDVVKAPKRSVISKWCKQILEGL
NYIHTHDPPVIHRDLKCDNLFIDASEGIVKIGDFGLSKITETGQAASCMGTPAYTAPEVY
LGNYTTKADIWSFGLCVLEMMTGETPYSECVGIGAIYLKVSGGYMPASLAKVSDPVIADF
ITMCLLPQEDRPSAADLLEHNLILEFEQPEMEAKENEFDYVQNPDFLALIARQEEELTEV
KARMREARRNLRAKIRQRKQTFEF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacccatgtaagcgatatcgcaggtgcgaattcatcggaagtggttcatacaaaatt
gtgtaccgcgcatatgatcaagaagaaggtattgaagtcgcctggaacgaaattcgtctt
gacaagtttaacgaagtcgaaagtaatcaaattaagcaagaaatttcaattttacatcag
ttagatcacccatccatcctcaaaattttctcagcttggagagatttatcaagaaattca
atgattttcatcacagaattcttttcgaatggtacaatcagagcatacgtttcggatgtc
gttaaggcaccaaagagatccgttattagcaaatggtgcaaacagattttagaaggcctt
aattatatccacactcatgatccacctgttatccacagagatcttaagtgtgataacttg
ttcattgatgcaagtgaaggcattgttaaaattggtgattttggcctttctaagattaca
gaaacaggccaagctgcttcatgcatgggtacaccagcatatacagcgccagaggtttac
cttggtaattacacaacaaaagccgatatttggtctttcggtttatgcgttcttgaaatg
atgacaggagaaactccttattcagaatgcgtcggtatcggagctatctacttaaaagtt
agcggcggatatatgccagcttctcttgcaaaagtttccgaccctgttatcgctgatttt
attactatgtgccttcttccacaagaagaccgcccatcagctgcagatctcttagaacat
aacttaattctcgaattcgagcaaccagaaatggaagctaaagaaaatgaattcgattac
gtacaaaatcctgacttcttggcacttatagctcgccaggaagaggagcttaccgaagtg
aaggctagaatgagagaagctcgtcgcaatcttcgcgcaaaaatcagacaacgcaaacag
actttcgagttctaa

DBGET integrated database retrieval system