KEGG   Trichomonas vaginalis: TVAG_418720Help
Entry
TVAG_418720       CDS       T01022                                 

Definition
(RefSeq) CAMK family protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
tva  Trichomonas vaginalis
Brite
KEGG Orthology (KO) [BR:tva00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tva01001]
    TVAG_418720
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     TVAG_418720
Protein kinases [BR:tva01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   TVAG_418720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 Pkinase_fungal YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 4769388
NCBI-ProteinID: XP_001323658
UniProt: A2E7E2
AA seq 311 aa AA seqDB search
MTDQLKSKYKILKEIGQGGFSRVYLGESLKDQKKVAIKVISKTNDLCEMKDIQKEIKIQK
QFESPYIVTFYDMYETKKEIVIVMEYVNGGELFDHIVQKGSFTEQEAANIIQQVLIGLKV
LHEKKVIHRDLKPENLLLFIDEKGNTTVKIADFGLSGLIDNSEDMKRFCGTEGYAAPEIM
KNVPYDWSVDVWSLGVIVYNLVSGYKPFDSDDDYELYEQVVAADYEFFSPEFDCISDECK
DFITHMLQAKAKDRYTVEMLLEHPWIKGNAPKVEITDLQSHLREFNAKRKLRRALLAAKS
AVKFAAFAGED
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcagctgaagagtaagtacaaaattctcaaagagatcggtcaaggtggattc
tcacgtgtttatcttggtgagagcttgaaagaccagaaaaaagttgctattaaagtaatt
tcgaaaacaaatgatttatgtgagatgaaagatattcaaaaagagatcaaaattcagaag
caattcgaatcaccttacattgttaccttttatgacatgtatgaaacaaagaaagaaatt
gttatcgtcatggaatacgtcaacggcggcgagctatttgatcatattgtccaaaaaggt
agctttacagagcaagaagctgctaatattatccagcaagttttgatcggactcaaagtt
ttacacgaaaagaaggttatccatcgcgatctaaagccagaaaatttacttttatttatt
gatgagaaaggaaatactacagtcaagattgcagacttcggacttagtggattaatcgat
aattcagaagatatgaagagattctgtggaacagaaggatatgcagctcctgaaatcatg
aaaaatgttccttatgactggtctgttgatgtttggtcccttggagtaatcgtttacaac
ttagtcagtggttacaagccatttgactctgatgatgattatgaattatatgaacaagtc
gttgccgctgattacgagttcttttctcctgaattcgactgcatttctgacgaatgcaaa
gatttcatcacacatatgcttcaagcaaaggctaaggatcgttacactgttgagatgctt
ttagagcacccttggatcaaaggtaacgctcctaaggttgaaattacagatcttcagtca
catcttcgtgaattcaatgctaagaggaagcttcgtagagcgcttcttgccgcaaagtcg
gctgtaaaatttgctgcattcgcaggagaggattaa

DBGET integrated database retrieval system