KEGG   Trichomonas vaginalis: TVAG_426660Help
Entry
TVAG_426660       CDS       T01022                                 

Definition
(RefSeq) Clan CD, family C13, asparaginyl endopeptidase-like cysteine peptidase
Organism
tva  Trichomonas vaginalis
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 DUF2686
Motif
Other DBs
NCBI-GeneID: 4772460
NCBI-ProteinID: XP_001326695
UniProt: A2DYT2
AA seq 388 aa AA seqDB search
MFCLLQLARCDRFAVLIAGSNDFYNYRHQADIFNMYQQLVKRGFDDQHITMMAYDDIALS
SENPFRGKVFHTLKHVNIYPGSSKINYAHNSVTADQFYTVLTTLKSTTSDNVYIYYDNHG
GPGILGVPDGVPGGYIEAEPLAKAFDTMEAKGLYGKLFFGIEACYSGSVAAVFRAKNMCT
ITAANDDESSYAAVYDSTVGAYLSNEFSNYFMAYLDSNPQNTIGNLYTKVKAQTTGSHVC
YYGDVNMKNLKLSDFLGTPNEVVAPKADAKIDIIPHYLATKSTLYQLAQSTDAKIAGRAK
VALHEVIAAAEKLDLTLTSIAEILEPETKNVLRAKCGKITPEYFEVLHYFTEKYGVVKGD
DMIKLRVLVNLALKHKVADIKAAIDAIC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttctgccttcttcagctcgcaaggtgtgatagattcgcagttcttattgctggttcc
aacgacttctacaactatcgccaccaggccgatatcttcaacatgtaccagcaacttgtt
aagcgtggattcgatgatcagcacatcacaatgatggcttatgatgatattgctttatca
tctgaaaacccattcagaggcaaggtcttccacacacttaagcacgtcaacatctaccca
ggttcctccaagatcaactacgctcacaattccgtcacagctgaccagttctacacagtc
cttacaacactcaagtccacaacaagcgataacgtctacatctactacgataaccacggt
ggcccaggcattcttggtgttccagatggtgttccaggaggctacatcgaggctgaacca
cttgctaaggccttcgacacaatggaagctaagggactttacggcaagctcttcttcggt
atcgaagcttgctactccggctccgtcgctgctgtcttccgtgctaagaacatgtgcaca
atcacagctgctaacgatgatgaatcatcctatgctgctgtctacgattccacagtcggc
gcatatctttccaacgaattctccaactacttcatggcctacctcgattccaacccacag
aacacaatcggcaacctctacacaaaggtcaaggcccagacaacaggctcccacgtttgc
tactacggtgatgtcaacatgaagaacctcaagctctccgacttcctcggcacaccaaac
gaggttgttgctccaaaggctgatgctaagatcgacatcatcccacactacctcgctaca
aagtccaccctctaccagcttgctcagtcaacagatgctaagatcgctggccgtgctaag
gttgctctccacgaggttatcgctgctgctgaaaagctcgatctcacactcacatctatc
gctgaaatcctcgagccagagacaaagaacgttctccgtgctaagtgcggcaagatcaca
ccagaatacttcgaggtcctccactacttcacagagaagtatggcgtcgtcaagggtgat
gacatgatcaagctcagagttcttgttaacctcgctctcaagcacaaggttgcagacatc
aaggctgctattgatgccatctgctaa

DBGET integrated database retrieval system