KEGG   Trichomonas vaginalis: TVAG_459150Help
Entry
TVAG_459150       CDS       T01022                                 

Definition
(RefSeq) 40S ribosomal protein S13
  KO
K02953  small subunit ribosomal protein S13e
Organism
tva  Trichomonas vaginalis
Pathway
tva03010  Ribosome
Module
tva_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TVAG_459150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tva03011]
    TVAG_459150
Ribosome [BR:tva03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    TVAG_459150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 4769801
NCBI-ProteinID: XP_001324066
UniProt: A2D9L2
Structure
PDB: 

AA seq 151 aa AA seqDB search
MGRLHSQGKGISSSTCPYRRSAPHWLQLSAENCVQMICDYAKKGVRPSQIGALLRDRNGV
GMVRAVTGVKVLRILKANGLAPALPEELYHLIKKATNVRKHLEHAKHDVDGKYRLILIES
RIHRLTRYYKTRRVLAPNWKYNAQTASALVA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcttcactcccaaggcaaaggtatcagctcctcaacatgcccataccgtcgt
tcagccccacactggctccagctctctgctgagaactgcgtccagatgatctgcgattat
gctaagaagggtgttcgcccatcacagatcggcgctcttcttcgtgaccgcaatggcgtt
ggtatggtccgcgctgtcacaggcgttaaggtcctccgtatccttaaggctaatggcctc
gctccagctcttccagaagaactttaccaccttatcaagaaggctacaaacgttcgcaag
cacctcgaacacgccaagcacgatgttgatggcaagtaccgtcttatccttatcgagtct
cgtattcaccgtcttacacgttactacaagacccgccgtgttcttgctccaaactggaag
tacaacgctcagacagcttctgctctcgttgcttaa

DBGET integrated database retrieval system