KEGG   Trichomonas vaginalis: TVAG_495060Help
Entry
TVAG_495060       CDS       T01022                                 

Definition
(RefSeq) STE family protein kinase
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tva  Trichomonas vaginalis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    TVAG_495060
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TVAG_495060
Protein kinases [BR:tva01001]
 Serine/threonine kinases: STE group
  STE7 family
   TVAG_495060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH DUF1679 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 4748355
NCBI-ProteinID: XP_001303599
UniProt: A2FWP1
AA seq 348 aa AA seqDB search
MSIYNRRKGNTLPKLDSDSGFFSNVDKTADPLRESTDFGDIKTKSDGTMLFTDEYPRICL
DDLNVKELIGAGTQGTVSDVIHIPSGREFAMKNIHVIDKTTLQKTIDEIHSLRKLKHTNV
VQLFTVFYQKGDIHILMDLVRGASLGDYIKVVPVVPEKALGQIAIQCLSGLLFMRKNHIL
HRDLKPSNVMVALDGSVKIADFGLARQLRATGDLAKSFTGTMSYMSPERIREDNYGLKSD
VWSLGVILYQCAIGKFPFGGMKIAFWDVNFDSSDEVDVKLPPECSENMRDFISRCLEVDT
NARASIEELVEHPWAKEFSGIREFADLVSWVADAEQKRKAAKPVSESK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctacaatcgaaggaaaggcaacacattgccaaagctcgattcggattcagga
tttttttctaatgtcgataaaacagctgatccattgagagaatcaactgattttggagat
atcaaaaccaaatcagatggaacaatgctttttactgacgaatatccacgtatttgcctt
gatgacttgaatgttaaagaacttataggagcaggcacccaaggaaccgtttcagatgta
attcatattccttcaggccgcgaatttgcaatgaaaaatattcatgttatcgacaaaact
acacttcagaaaactattgacgaaattcattctttgagaaagcttaaacatacgaacgtt
gtccaacttttcactgttttctatcagaaaggagatattcatattttaatggatttagtt
cgtggtgcatcacttggcgattatattaaagtcgtcccagttgttccagaaaaagcccta
ggtcaaatcgcaattcaatgtctcagcggcttactcttcatgcgtaaaaaccatatcctc
catcgtgatcttaaaccatccaatgtaatggttgcccttgatggatctgttaaaattgca
gattttggacttgcacgccaacttcgcgcaactggtgatcttgccaagtcgtttacaggt
acaatgtcatacatgtcaccagaacgcattcgcgaagataattacggccttaaaagcgat
gtttggtctcttggtgttattttatatcaatgcgcaattggtaaattcccatttggtggt
atgaagatagccttttgggatgtcaacttcgactcttctgatgaggtcgatgttaaatta
cctccagaatgttcagagaatatgagagattttatttcaagatgcttagaagtagacaca
aatgcaagagcttctattgaagaactagttgagcatccatgggcaaaagaattctcggga
attagagaatttgcagatctcgtttcctgggtagcagatgcagagcaaaagaggaaggct
gcaaagcccgtaagtgaaagcaaataa

DBGET integrated database retrieval system