KEGG   Trichophyton verrucosum: TRV_00674
Entry
TRV_00674         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tve  Trichophyton verrucosum
Pathway
tve00100  Steroid biosynthesis
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TRV_00674
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TRV_00674
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9580642
NCBI-ProteinID: XP_003025149
UniProt: D4D0S9
AA seq 500 aa
MTLADRKFLPRLDTSMSSLRLADDDTCRPGAAAITFGLPVLLLFFAFGCNDVTGCPVPSL
LYPKTFTWEQFKLESGWPAGGIWDLFSWNVTAVVLGYYLVSLVLWKFLPAQEIKGTKLVH
HGKGLDYRFNAFSSSIVHLAVCAIGTYFQGANFFVWTYITDNYVQLLTANIVIAYAISVY
VYLKSFSVDTNYPNKDLRELAIRGNTDNTIYDFYIGRELNPRVTLPLFGEVDLKTWLELR
PGLTGWVLLDLAFVAKQYRTYGRLSDSIVFTAFVQTYYALDGQHKESAILTMMDTTTDGL
GFMLTFGDIVWVPFLYSTQCRYLSVYPVHLGWAGVAIVSAVFAMGLYIFRASNTQKNVFR
TRPNDPSVAGLSYIQTKRGTKLLTSGWWGISRHINYFGDWLQASPFSWPTGLAGYMILPA
GSAAAAAATQQTFTMLDGREVVQGEAKGWGIIFTYFYVLYFAILLMHRERRDDGACFKKY
GEDWNRYKAIVKWRILPWVY
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgactttggcggaccgtaagtttctcccccggctcgatacatctatgtcctccctcagg
ttggctgacgatgatacctgcagaccgggtgcggcagccataacatttggccttccggtg
ctgctgctcttctttgcattcgggtgcaacgatgtgactggctgtccggtgccgtcactg
ctgtacccgaagacatttacctgggagcagttcaagctggagagcggatggccggccggg
ggcatctgggaccttttcagctggaacgttaccgctgtcgtgttgggctactatctggtc
agcttggtcctgtggaaatttctaccagcgcaggagatcaagggaacgaagctcgttcac
catgggaaaggattggattaccgcttcaacgcattctcatcaagtattgtacatttggct
gtctgtgccattggaacatacttccagggcgccaatttcttcgtctggacgtatatcaca
gacaattacgtgcagctgctcacggccaacattgtgatagcctatgcaatctctgtctat
gtctatctcaagagcttcagcgtggataccaattatcctaacaaggacctgcgtgagctg
gctatccgtggaaatacagacaataccatctatgacttttatatcggccgcgagttgaat
cctcgtgtcactcttcctcttttcggtgaagtggatctcaagacctggctagagctgcgt
ccaggccttaccggctgggtcctgctggacctcgcctttgtcgcaaagcaataccgtact
tatgggcggttgtcggatagcattgtctttaccgcgtttgtgcagacgtactatgctctt
gacggccaacacaaggagtcggccatcttgactatgatggacactaccaccgacggactt
ggatttatgcttacgtttggtgatattgtctgggttccgttcctgtactcaactcagtgc
cgctatctctccgtatatccggtacaccttggttgggcgggcgtcgcaattgttagtgcc
gtgtttgctatgggcttgtacatcttccgagcatcaaacacccagaagaacgtcttccgc
acacgcccaaatgatccgagtgtggctgggctatcttatatccaaacaaagcgaggaacc
aagctgttgacatctggatggtggggcatatcccgccatatcaactattttggcgactgg
ttgcaggcttctcccttcagctggcctacgggcttagccggttacatgatcttgccagcc
gggagtgctgctgctgctgctgctactcagcagacattcaccatgttggacggcagggag
gtagttcagggggaagcgaagggctggggtattatttttacgtacttttacgtgctttac
tttgccatcctgctgatgcatcgtgaacgacgagacgacggggcatgctttaagaagtat
ggtgaggactggaacaggtacaaggctattgtcaaatggaggattctaccatgggtttat
tag

DBGET integrated database retrieval system