KEGG   Trichophyton verrucosum: TRV_00956Help
Entry
TRV_00956         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tve  Trichophyton verrucosum
Pathway
tve00511  Other glycan degradation
tve00513  Various types of N-glycan biosynthesis
tve00520  Amino sugar and nucleotide sugar metabolism
tve00531  Glycosaminoglycan degradation
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_00956
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    TRV_00956
   00531 Glycosaminoglycan degradation
    TRV_00956
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TRV_00956
   00604 Glycosphingolipid biosynthesis - ganglio series
    TRV_00956
   00511 Other glycan degradation
    TRV_00956
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRV_00956
Chaperones and folding catalysts [BR:tve03110]
 Intramolecular chaperones
  Others
   TRV_00956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 9580372
NCBI-ProteinID: XP_003024881
UniProt: D4D1K5
AA seq 605 aa AA seqDB search
MLWIWVAGILGLFGRVEALWPQPSEYSHGNKTLWLSPSVRFTYTNNQRSFIYTRPSYAGI
NWIPGGWLNLLQNPWGSAEQTVAEPLPNVEQFVEDAIKRTKHAIVNSKFVPWKFYPRHQK
FEPLVDGQHPTIEEVIINEASKTSQQWSPRNYVNGDEKYEIRISEDGEVQISSRSPIGTI
RALQTFQQLFYSHSHSKSYTPFAPISISDSPKWRHRGLNLDISRNVIRPEDVKRTIDAMA
SVKLNRLHFHAADSQSWPLDIPSIPELAAKASYHPSQVWSSSELEAVQLYGLERGVSVFL
EIDLPGHTAAVGHAFPDLVAAYHMDQWEKYAAEPPSGQIKLNSSAVYQFLDLLMADLIPR
VSPLTEYFHTGGDEFNLNTYLLEINLGSNDRRVLTPFLDRMITHVHSSLRSSGVTPIVWE
ELVLDWDLNLPSHKTAGETGGVIVQAWRNSSAVKHVLQKGYQTIFGTGDAWYLDCGVGTF
LNPRPGSKAVQNPYLDWCAPTKNWKHMYVYNPLKDIPVELQSLLVGGETHMWSELVDPVN
MDQMIWPRAAAAAEVLWTGPRSPDNIQDASYRLVKWRERVVSDAGIRAAMVQMTYCLMRE
SGCEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggatctgggttgctggaatcctaggcctgtttggccgtgtagaagcgctatgg
ccacaacccagtgaatactcacacgggaataaaaccctgtggctgtctccatccgtccgg
tttacctacactaacaatcagcggtcttttatatatacgcggcctagttatgcaggcatt
aactggatacccggaggctggctaaacctgctgcagaacccttggggtagcgcagaacaa
acagttgcagaaccgctccccaatgttgagcaatttgttgaagatgctataaaacgtacc
aagcatgctattgttaatagcaaatttgtcccttggaagttttatccgcgtcatcaaaag
tttgaacccttggtagatggccaacatccgactatcgaagaggttataatcaatgaggcg
tcaaaaacgagtcaacaatggtctcctcgcaactacgttaatggggatgaaaagtacgaa
attaggatctcggaagatggtgaggtgcagatctcctcgagatcaccgattggcactatt
cgtgctcttcaaacattccagcagctgttttactcccactcccattcaaagtcatacaca
ccctttgctccaatttccatatcggattctcccaaatggcgacatcgtgggctgaacctt
gacatatctagaaacgtgattcgacccgaagacgtcaagcgcactattgatgcaatggca
tctgtaaaactgaaccggctgcatttccacgctgccgactcacaatcctggccgttggac
attccttcaatcccagaactagcagccaaagcctcgtaccatccgagtcaggtatggtcg
tcttctgaattggaggcggtgcaactatatggactagaacgcggggtctcggtattcctt
gagattgatttgcccggccatactgctgccgttggccatgcattccccgatttagttgca
gcctaccatatggaccagtgggagaaatatgccgcggaacctccaagtggtcaaattaaa
ctgaattcttctgccgtataccagttccttgatctgctgatggcagatttaatcccacgt
gtctccccgttaacagaatactttcacactggaggagatgaattcaacctcaatacctac
cttttagaaattaacctaggctcaaatgaccgacgagtcctcactccctttctcgacaga
atgatcacacatgttcacagctcacttcgaagttctggagttactccgattgtatgggaa
gagttggtccttgattgggatctcaacctgccttctcacaaaacagcgggtgaaactgga
ggggtcatcgtgcaggcatggcgtaactcatcagcagtgaaacatgtcctccaaaaaggg
tatcagacgatatttggcactggagatgcttggtatcttgactgcggggtaggaactttc
ctaaaccctcgcccaggttccaaggcagtccagaatccgtatctagactggtgtgcaccg
acgaaaaactggaaacacatgtatgtatacaaccctctaaaggatatacctgtcgagtta
cagtcccttctggttggaggtgaaacgcatatgtggtcagagctggttgatccagtcaac
atggaccaaatgatctggccccgggccgccgccgccgccgaagttctttggacagggccg
agatcgccagataatatccaggacgcctcatatcgattggtaaagtggagagagcgcgta
gtgagtgatgccggaatccgtgctgctatggtccaaatgacgtattgtctcatgcgggaa
agcggatgcgagctctaa

DBGET integrated database retrieval system