KEGG   Trichophyton verrucosum: TRV_01090Help
Entry
TRV_01090         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tve  Trichophyton verrucosum
Pathway
tve03040  Spliceosome
tve04141  Protein processing in endoplasmic reticulum
tve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TRV_01090
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRV_01090
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    TRV_01090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tve01009]
    TRV_01090
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tve03041]
    TRV_01090
   03009 Ribosome biogenesis [BR:tve03009]
    TRV_01090
   03110 Chaperones and folding catalysts [BR:tve03110]
    TRV_01090
   04131 Membrane trafficking [BR:tve04131]
    TRV_01090
   03051 Proteasome [BR:tve03051]
    TRV_01090
   03029 Mitochondrial biogenesis [BR:tve03029]
    TRV_01090
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tve04147]
    TRV_01090
Protein phosphatases and associated proteins [BR:tve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TRV_01090
Spliceosome [BR:tve03041]
 Complex B
  Other components
   Prp19 complex
    TRV_01090
 Complex C
   Prp19-CDC5 complex
    TRV_01090
Ribosome biogenesis [BR:tve03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    TRV_01090
Chaperones and folding catalysts [BR:tve03110]
 Heat shock proteins
  HSP70 / DNAK
   TRV_01090
Membrane trafficking [BR:tve04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    TRV_01090
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    TRV_01090
Proteasome [BR:tve03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    TRV_01090
Mitochondrial biogenesis [BR:tve03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    TRV_01090
Exosome [BR:tve04147]
 Exosomal proteins
  Proteins found in most exosomes
   TRV_01090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 9580231
NCBI-ProteinID: XP_003024741
UniProt: D4D1Y8
AA seq 662 aa AA seqDB search
MAPAVVIANIFPGIDLGTTYSCVGIFRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDAA
KNQVAMNPVNTVFDAKRLIGRKFNDAEVQADMKHFPFKVVEKGGKPIVQVEFKGEEKQFT
PEEISSMVLTKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINE
PTAAAIAYGLDKKTEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDN
RLVNHFVNEFKRKNKKDLSTNARALRRLRTACERAKRTLSSAAQTSIEIDSLYEGVDFYT
SITRARFEELCQDLFRSTMEPVERVLRDAKIDKSSVHEIVLVGGSTRIPKIQKMVSDFFN
GKEPNKSINPDEAVAYGAAVQAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTPLI
KRNTTIPTKKSETFSTFSDNQPGVLIQVFEGERARTKDNNLLGKFELTGIPPAPRGVPQI
EVTFDVDANGIMNVSALEKGTGKTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAETA
RIGAKNGLESYAYSLKNTLSDSKVDEKLDAADKEKLKSEIDKVVAWLDDNQTATKEEYES
QQKELEGVANPIMMKFYGAGGEGGAPGGFPGAGAGGPGGFPGAGGAGGAAAHDDGPTVEE
VD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgcagttgtgatagctaacatcttcccaggtatcgatttgggtaccacgtac
tcctgcgtgggtatcttccgtgatgaccgcattgaaatcatcgccaacgaccagggaaac
cgcactaccccatccttcgttgccttcacagacaccgagcgtctcattggagatgctgca
aagaaccaggtcgccatgaaccctgtcaacaccgtcttcgatgctaagcgtctcattgga
cgcaagttcaacgacgccgaggtccaggccgacatgaagcacttccccttcaaggttgtc
gagaagggcggcaagcccatcgtccaggtcgagttcaagggcgaggagaagcagttcact
cccgaggaaatctcctccatggtcctcaccaagatgcgtgagaccgccgaggcttacctt
ggtggcaccgttaacaacgctgtcatcactgtccctgcctacttcaacgactcccagcgt
caggctaccaaggacgccggtctcattgccggtctcaacgtcctccgtatcatcaacgag
cccaccgctgctgccattgcctacggtctcgacaagaagaccgagggtgagcgcaacgtt
ctcatcttcgatctcggtggtggtaccttcgatgtctccctcctgaccatcgaagagggt
atcttcgaagtcaagtccactgccggtgacactcacttgggtggtgaggactttgacaac
cgtctcgtcaaccacttcgtcaacgaattcaagcgcaagaacaagaaggatctctccacc
aatgctcgtgctctccgccgtctccgcaccgcctgcgagcgtgctaagcgtactctctcg
tctgctgcccagacctccattgagattgactctctctatgagggtgttgacttctacacc
tccatcacccgtgcccgtttcgaagagctctgccaggacctcttccgctccaccatggag
cctgtcgagcgtgtcctccgtgacgccaagatcgacaagtcctctgtccacgagattgtc
ctcgtcggtggttctactcgtatccccaagatccagaagatggtctccgacttcttcaac
ggcaaggagcccaacaagtccatcaaccccgatgaggccgttgcctacggtgctgccgtc
caggccgccatcctctctggtgacacctcctccaagtccaccaacgagatcctcctgctc
gatgttgctcccctctctctcggtatcgagactgctggcggtgtcatgactcctctcatc
aagcgcaacaccaccatccctaccaagaagtctgagactttctccaccttctctgacaac
cagcccggtgtcttgatccaggtcttcgagggtgagcgtgctcgcaccaaggacaacaac
ttgctcggcaagttcgagctcactggtatcccacctgccccccgtggtgttcctcagatc
gaggtcaccttcgatgtcgatgccaacggtatcatgaacgtctctgctctcgagaagggc
actggaaagaccaacaagattgtcatcaccaacgacaagggccgtctgtccaaggaggag
atcgagcgtatgcttgctgaggctgagaagtacaaggccgaggacgaggccgagactgcc
cgtatcggtgctaagaacggcctcgagtcctatgcctactccctcaagaacactttgagc
gactccaaggtcgacgagaagctcgacgctgccgacaaggagaaactcaagtccgagatc
gacaaggtcgttgcttggctcgatgacaaccagactgccaccaaggaggaatatgagtcc
cagcagaaggagcttgaaggtgttgccaaccccatcatgatgaagttctacggtgctggc
ggtgagggtggtgccccaggtggtttcccaggcgctggtgctggcggccctggcggtttc
cccggtgccggtggtgccggtggcgctgctgcccacgacgacggcccaaccgtcgaggaa
gtcgactaa

DBGET integrated database retrieval system