KEGG   Trichophyton verrucosum: TRV_01364Help
Entry
TRV_01364         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tve  Trichophyton verrucosum
Pathway
tve00030  Pentose phosphate pathway
tve00480  Glutathione metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tve_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRV_01364
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRV_01364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tve04147]
    TRV_01364
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TRV_01364
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TRV_01364
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TRV_01364
  Exosomal proteins of colorectal cancer cells
   TRV_01364
  Exosomal proteins of bladder cancer cells
   TRV_01364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 9579698
NCBI-ProteinID: XP_003024476
UniProt: D4D2Q8
AA seq 487 aa AA seqDB search
MELKDDTVIVVLGASGDLAKKKTYRNKFLPKDIKIVGYARTKMDHDEYVRRIRSYIKVPT
KELEEQLNGFCELCSYISGQYDQDESFITLRNHLEELEKGRKEQNRVFYMALPPSVFITV
SQHLKKNCYPENGITRIIVEKPFGKDLGSSRELQRALEPNWREDEIFRIDHYLGKEMVKN
ILILRFGNEFFGATWNRHHIDNVQITFKEPFGTEGRGGYFDEFGIVRDVMQNHLLQVLTL
LAMERPISFSAEDIRDEKVRVLRGIDAIEPKNVIIGQYGKSLDGTKPAYKEDETVPKDSR
CATFCAMVAYIKNERWDGVPFILKAGKALNEQKTEIRIQFRDVTSGIFKDIPRNELVIRV
QPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAYESLILDALKGDHSNFVR
DDELDASWRIFTPLLHYLDDNKEIVPMEYPYGSRGPAVLDDFTSSFGYKFSDAAGYQWPL
TATPNRL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagctcaaggacgacaccgtcatcgtcgtcctgggtgcttcgggagacctagcaaag
aagaagacttatcgcaacaagttcctgcccaaggacatcaagatcgttggatatgctcgc
accaagatggatcatgatgaatatgtccgacgaatccggtcctatatcaaagtccctacc
aaggagctcgaggagcagttgaatgggttctgcgagctctgctcctacatatctgggcag
tacgaccaggatgaatccttcatcacccttagaaaccacctggaggaattagaaaagggc
cgaaaggagcaaaacagggtcttctacatggccctgccgccaagcgtgttcatcaccgtc
tcccaacacctcaagaagaactgctacccagaaaatggcatcacgaggataattgtcgag
aagccgtttggaaaagatctaggtagctcccgagagctacagagggctcttgaacccaat
tggcgggaggacgagatattccgtatcgatcactaccttgggaaggaaatggtgaaaaat
atcctcattctacgtttcggaaatgagttcttcggtgccacctggaaccggcaccacata
gataacgtccagatcacgtttaaagagccgtttggtactgagggccgtggcggctacttt
gatgagttcggaattgtcagagatgtcatgcagaaccatcttctccaagttctaaccctg
cttgccatggagcgtccgatatcgttctctgcagaagacatccgtgatgaaaaagtgaga
gtgttgaggggtatcgatgcgattgagcccaagaacgtcatcatcggccagtacggaaag
tctctagacggcactaaacctgcatacaaggaagatgagactgtccccaaggactccaga
tgtgctaccttttgtgcaatggttgcatatatcaagaacgagcgatgggacggggttccc
tttatcctgaaggctggcaaagctctcaacgaacaaaagacggagattcgcatccagttc
cgcgatgttacctccggtatatttaaagatatccccagaaacgagctggtcattcgtgtc
cagcccaacgaatcggtatatatcaaaatgaattcaaaactccctgggctctcaatgcag
actgtcgtcaccgagcttgatctcacataccgtcgacgattctcggacttgaagatccca
gaagcctatgaatccctcatcctggatgcactcaagggagatcattccaactttgtccgt
gatgacgagcttgatgccagctggaggatctttaccccattgttgcactatcttgatgac
aacaaagaaatagtcccaatggagtacccctatggctctcgaggacctgctgtcctcgat
gacttcacctcatctttcgggtataagttcagcgatgctgcaggctaccagtggccactt
accgcaacacccaaccgcctgtga

DBGET integrated database retrieval system