KEGG   Trichophyton verrucosum: TRV_01447Help
Entry
TRV_01447         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
tve  Trichophyton verrucosum
Pathway
tve00510  N-Glycan biosynthesis
tve00513  Various types of N-glycan biosynthesis
tve01100  Metabolic pathways
tve04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    TRV_01447
   00513 Various types of N-glycan biosynthesis
    TRV_01447
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRV_01447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribophorin_I
Motif
Other DBs
NCBI-GeneID: 9579520
NCBI-ProteinID: XP_003024381
UniProt: D4D2Z1
AA seq 497 aa AA seqDB search
MKLLAALLLSCGLVSATAANTTATEPAIQVLPKNFRPPQVFRNNNLVRIINLEKSYVRES
INVVVENVDKRPQSEYYVAFPTDTINKVGGLEGWPKDSEEKKKFTVTSTRQVPSSSHQYF
IIHLHQPLEPAAKLTLTLSYHLQSALTPILAAIEQDGKQYLSYTFPQFVPSAYTTNKQKT
TVKFRGTDVPDYTRPTTLKSEEDPKREGSTFTYGPYDMEVKPGTSAPITVRYEYTRPVVT
CTRLERDIEISHWGGNMATEDRFWFRNDAAKLTKQFSRVEWTKKQFHNAQSVALNLLRVP
LAPGSVNPYFIDDIGNVSTSRFLPATETRLGLLDLRPRYPIFGDWKYSFKIGWNNPLSSV
LRKQKTGSGESYVLKVPFIDGPKIPEGVQYQDLEIRIILPEGAENVKYEIFDGLGIPNHI
RSEISYYKTFLDTKGRTVLNLSTTKVGDEAKDGFIIVTYDYPFLAAFRKPLSIFGAMLAV
FTAAWVLGNIDVSIKRR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgccgcgctgctgctctcgtgcggcctcgtctctgcgacggccgcaaac
accacagctacagagcccgccatccaggtcctaccgaagaacttcaggccgccgcaggtc
ttccggaataacaacctagtgcgcataatcaatttggagaagagctatgtgcgggagtcg
atcaacgttgtggttgaaaatgtcgacaagcggccgcagtcagagtactatgtggccttt
ccaacagacacaatcaacaaagtcggcggcctcgaaggctggccgaaagactcggaagag
aagaagaagttcacagtaacgtcgacacggcaggttccttcaagctcgcatcaatacttc
atcatacaccttcatcaacctctcgaaccggctgcaaagctgaccctgacgctgtcatac
catctgcaatccgctcttactcctattctggctgcaattgaacaggatggcaagcaatat
ctctcctataccttcccgcagttcgtgccgtccgcgtacaccaccaacaagcagaagacg
accgtcaagttccgtggcacagatgttccagactacactcgacctaccactctcaagtcc
gaagaggaccctaagcgtgaaggcagcacctttacatatggcccgtatgatatggaagtc
aaaccaggcaccagtgcacccatcaccgtccgctacgagtacacccgacccgtggtgacc
tgcactcgcctcgagcgtgatatcgagatatcccactggggcggtaatatggccactgaa
gaccgattctggtttagaaacgacgctgccaaactgaccaaacagttctcccgagtcgaa
tggaccaagaagcagttccacaacgcacagagcgtagctttgaacttgctcagagtgccc
cttgctccagggtctgtcaacccttacttcattgacgacatcggcaatgtctcgactagc
cgattcctacctgctacagagactcgtctcggcctcttggatttacgcccacgttacccc
atcttcggcgattggaagtacagcttcaagatcggctggaacaacccactctccagcgtt
ttgcggaaacagaaaactggctctggcgagtcctacgttctcaaagtgcccttcattgac
gggccaaagatccctgagggcgttcagtatcaggacttggaaatcagaatcattctgccc
gagggagctgagaatgtcaaatacgagatttttgacggattgggtattcccaaccatatc
cgctctgaaatttcatactacaagacctttttagataccaagggtagaactgtcctgaat
ctctccactaccaaggttggagatgaggccaaggatggattcatcatcgtaacatacgac
tatcctttcctcgctgccttcagaaaaccattgagcattttcggcgctatgcttgcagtc
ttcactgccgcatgggtcctgggtaatattgacgttagcattaaaaggaggtag

DBGET integrated database retrieval system