KEGG   Trichophyton verrucosum: TRV_03446Help
Entry
TRV_03446         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K16944  septin 7
Organism
tve  Trichophyton verrucosum
Brite
KEGG Orthology (KO) [BR:tve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tve04131]
    TRV_03446
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tve04812]
    TRV_03446
   04147 Exosome [BR:tve04147]
    TRV_03446
Membrane trafficking [BR:tve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    TRV_03446
Cytoskeleton proteins [BR:tve04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     TRV_03446
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_03446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU ABC_tran AAA_16 RsgA_GTPase Roc AAA_22 Ras AIG1 AAA_29 Dynamin_N AAA_24 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 9580929
NCBI-ProteinID: XP_003022382
UniProt: D4D8K9
AA seq 537 aa AA seqDB search
MEEKVVKVGLVVEKMAAMLPEIPIAEPITILPEPEPEPEPDSGSDYTRSLETATETENSS
EPEVDSDKKSDSETDIDPPAASNGIPTPTRPSPAPPSPHVSPHVERSNPMGHGAAQTVSS
KDPKAAAQAASDMKNVVRRKLAGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTL
VNTLFNTSLYPPRERTGPSLDIIPKTVSVESISADIEENGVRLRLTVVDTPGFGDFVNND
DSWRPIVENIEQRFDAYLDAENKVNRMNIVDNRVHACVYFIQPTGHSLKPLDIEVMRRLH
TKVNLIPVIAKADTLTDEEIALFKQRILADIQHHSIQIFEGPRYELDDEETIAENKEIMS
KVPFAVVGANSEVTSADGRKVRGRRYPWGVIEVDNEEHCDFVKLRQMLIRTHMEELKEHT
NNTLYENYRSDKLTQMGVTQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKV
QEKESKLKQSEEELFARHREMKEQLDRQRQELEEKKARLESGRPLEDKIKRKGFSLR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaagtggttaaagtcggcctggtggtcgagaagatggctgccatgctgcct
gagatccccatagcagagcccatcaccatcctgccagagccagagccggagccggagcca
gactcgggctctgactacacccgctcgctggagactgcgacagagaccgagaacagcagc
gagcccgaggttgatagtgacaagaagagtgactctgagactgacattgaccctccagct
gcgtctaacggcatcccaacgcccacccggccctcgccagcaccgccatccccccatgtc
tctcctcacgtcgaacgcagcaacccgatgggccacggagcagcccagacagtcagctcg
aaggaccccaaggccgctgcccaggctgccagtgacatgaagaacgttgttcgccggaaa
ctggccggctacgttgggtttgccaacctgccaaaccagtggcaccgcaagagtgtacga
aaggggttcaactttaacgtcatggtcgttggtgagtctggcctgggaaaatcgacgctg
gtcaacacactcttcaacacatctctatatcccccacgagaacgtactggccccagcctg
gacatcatccccaagaccgtctccgtcgagtccatcagtgcagacatcgaggagaacggc
gtccgtctgcgtttgaccgtcgttgacacccccggattcggagactttgtcaacaacgac
gactcgtggcgtcccattgtcgagaacatcgagcagcggttcgatgcctacctcgacgcc
gagaacaaggtcaaccgcatgaacatcgttgacaaccgtgtgcacgcctgtgtctacttc
atccagcccactggccactccctgaagccattggacattgaggtgatgcgccgtctgcat
accaaggtcaacttgatcccagtcattgctaaggctgacaccctgaccgacgaagagatt
gccctcttcaagcagagaatcttggctgatatccagcaccactcgatccagatcttcgag
ggcccacgctacgagctggacgacgaggaaaccattgccgagaacaaggagatcatgtcc
aaggtcccctttgccgtggttggtgccaactcggaagtgaccagcgctgacggccgcaaa
gtgcgtggccgccgctacccctggggcgtcatcgaggtcgacaacgaggagcactgcgac
tttgtgaagctgcgccagatgctgatccgcacacacatggaggagctcaaggagcacacc
aacaacacgctgtacgagaactaccgctcggacaagctgacgcagatgggcgtgacacag
gacccaagcgtcttcaaggaggtcaacccggccgtgaagcaggaggaggagcgcgccctg
cacgagcagaagctggccaagatggaggccgagatgaagatggtcttccagcaaaaggtg
caggagaaggagagcaagctgaagcagtccgaagaagagctgtttgcccgacaccgcgag
atgaaggagcagctcgaccgacagcgccaggagctagaggagaagaaggcccgtctcgag
agcggacggccgctggaagacaagataaagcgaaaggggttctctctccgttaa

DBGET integrated database retrieval system