KEGG   Trichophyton verrucosum: TRV_04098Help
Entry
TRV_04098         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
tve  Trichophyton verrucosum
Pathway
tve00730  Thiamine metabolism
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    TRV_04098
Enzymes [BR:tve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     TRV_04098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl Pyr_redox_2 NAD_binding_9 Trp_halogenase FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 9578647
NCBI-ProteinID: XP_003021767
UniProt: D4DAF1
AA seq 341 aa AA seqDB search
MAPPPTATLTETVASVGNVVRDNFAGEGNTLAQAAPEAGSGSGSGYALLDDFAGKWEEFK
FAPIRESQVSRAMTSRYFKDMDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIALIEAS
VSPGGGAWLGGQLFSAMVLRKPAHRFLDDLGVPYEEDASNPNLVVIKHAALFTSTLLSKV
LSFPNIKLFNATCVEDLITRPRASEASGFQIAGVVTNWTLVTQHHDDHSCMDPNTINAPL
IISTTGHDGPFGAFCAKRLVSMSALEKLGGMKGLDMNSAEEAIVKNTREVTKGLIIGGME
LSEIDGWHRMGPIFSAMMLSGLKAAEVALEVFEERKKECSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctccaccaccaactgctactcttactgagaccgttgcctctgttggcaatgttgtc
agagacaacttcgccggcgagggcaacaccctggcccaggctgcccccgaagctggctct
ggctctggctctggatacgctctgctggacgactttgccggtaaatgggaggagttcaag
tttgctcccatccgtgagagccaggtttcccgggccatgaccagccgttacttcaaggac
atggacacctacgccgagagcgacatcgtcatcgtcggtgctggctcctgcggtctcagc
accgcttatgtcctcggcaaggctcgtccagacctcaagattgctctgatcgaagcctct
gtctctcctggaggcggtgcctggcttggtggccagcttttctctgccatggtccttaga
aagcctgcccaccgcttcctcgatgacctgggtgtcccgtatgaggaggatgccagcaac
ccaaacctcgtcgtcattaagcatgccgccctcttcacttcgaccttgctctccaaggtg
ctctcattccccaacatcaagctcttcaacgcaacctgtgtcgaggacctgatcacccgt
cctcgcgcctctgaggcctcgggcttccagattgccggtgtcgtcaccaactggactctt
gtcacccagcaccacgatgaccactcctgcatggaccccaacaccatcaacgctccacta
atcatcagcaccaccggccacgacggcccattcggtgctttctgtgccaagcgtctcgtt
tctatgtctgcccttgagaaactcggaggtatgaagggactggatatgaactctgcggag
gaggccatcgtcaagaacacccgtgaggtcaccaagggcttgatcatcggtggaatggag
ctttctgagatcgacggatggcaccgtatgggcccaatcttctctgctatgatgcttagt
ggtctcaaggccgctgaggttgccctcgaggtctttgaagagcgaaagaaggaatgctct
gcataa

DBGET integrated database retrieval system