KEGG   Trichophyton verrucosum: TRV_04876Help
Entry
TRV_04876         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tve  Trichophyton verrucosum
Pathway
tve00020  Citrate cycle (TCA cycle)
tve00640  Propanoate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_04876
   00640 Propanoate metabolism
    TRV_04876
Enzymes [BR:tve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TRV_04876
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TRV_04876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 9577863
NCBI-ProteinID: XP_003021011
UniProt: D4DCM1
AA seq 292 aa AA seqDB search
MQSFRRSTLSALQNASRVQRRGFAGLTGYSSTVKNLRINADTKVIFQGFTGKQGTINACI
GTNVVGGTNPKKAGETHLGKPVFASVEEAVKETGATASAIFVPCHQELTSKKLIHSIVSL
KEFLSMGQCKIGIMPGFIHKRGRIGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFS
GTNFIDCLRVFLEDEETDGIIMIGEIGGSAEEDAAAFLKSENKANKPAVSFIAGISAPPG
RRMGHAGAIVSGGKGGADSKIAALQDAGVIVERSPASLGKTLLAEFVKRDIV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccttcagacgctctacgctctctgcgttgcagaatgcttcccgtgtccagcga
cgcggattcgcaggcctcacaggctattcctcgacagtaaagaacctccgcatcaacgca
gacaccaaggtcattttccagggcttcaccggaaagcagggaactattaatgcctgcata
ggaaccaatgttgtcggtggaacaaaccccaagaaggccggagagactcacctcggcaag
cccgtctttgcgagcgtcgaagaggccgtcaaggagaccggtgctactgcttccgccatc
ttcgttccctgtcatcaagaattaacctcaaagaaactaatacattccatagtatcactg
aaggaattcctcagcatgggacaatgcaaaatcggtatcatgccgggcttcatccacaag
agaggccgcatcggtattgtttcccgatccggtaccctcacctatgaagccgtcaaccag
accacccaagccggccttggccaatctcttgttgtcggtatcggcggtgaccccttctcc
ggaaccaacttcattgactgcctccgtgtcttccttgaggacgaggagaccgacggaatc
atcatgatcggtgaaatcggcggtagcgccgaggaagacgccgctgctttcctcaagagc
gagaacaaggccaacaagcctgccgtcagcttcattgctggtatcagtgctcctccaggc
cgacgaatgggccacgccggtgccattgtcagtggaggcaagggaggcgccgactctaag
attgctgctctccaagatgccggcgtcattgtcgagcgaagccctgcttccctcggaaag
actctcctggctgagttcgtcaagagagacatagtctaa

DBGET integrated database retrieval system