KEGG   Trichophyton verrucosum: TRV_05246Help
Entry
TRV_05246         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tve  Trichophyton verrucosum
Pathway
tve00230  Purine metabolism
tve00240  Pyrimidine metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Module
tve_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tve_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
tve_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TRV_05246
   00240 Pyrimidine metabolism
    TRV_05246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tve04131]
    TRV_05246
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     TRV_05246
Membrane trafficking [BR:tve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    TRV_05246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK TMEM141
Motif
Other DBs
NCBI-GeneID: 9577352
NCBI-ProteinID: XP_003020648
UniProt: D4DDN5
AA seq 95 aa AA seqDB search
MKLVTPSKEHLETHYADLSSKPFFKGLVSFLLGATNPADSAPGTIRGDYAIDVGRNVCHG
SDSVENAKKEIALWFKEGEVLSYKQSQFDWIYEKA
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtcactccctccaaggagcacctcgagacccactatgctgatctctccagc
aagccattcttcaagggactcgtctccttcctcctcggtgccaccaaccctgctgactct
gcccccggcaccatccgtggtgactacgccattgacgtcggccgcaacgtctgccacggc
tccgacagcgtcgagaacgccaagaaggagattgctctctggttcaaagagggagaggtc
ctcagctacaagcagagccagttcgactggatctatgagaaggcatag

DBGET integrated database retrieval system