KEGG   Trichophyton verrucosum: TRV_05526Help
Entry
TRV_05526         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
tve  Trichophyton verrucosum
Brite
Chromosome and associated proteins [BR:tve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TRV_05526
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_05526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RP-C DUF3915
Motif
Other DBs
NCBI-GeneID: 9584134
NCBI-ProteinID: XP_003020408
UniProt: D4DEF9
AA seq 130 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGKAPAEKKEAGKKKRTKARKETYSSYIFKVLKQVHPDTGISK
RAMSTLNSFVNDIFERVATEASKLAAYNKKSTISTREIQTSVRLILPGELAKHAVSEGTK
AVTKYSSSAR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagctgctgagaagaagccctcgaccggcggcaaggccccggctggcaaa
gctcccgctgagaagaaggaggccggcaagaagaagcgcaccaaggccagaaaggagacc
tactcctcctacatcttcaaggtgctcaagcaagtccaccctgacactggtatctccaag
cgcgccatgtccaccctcaactccttcgtcaatgacatcttcgagcgcgttgctaccgaa
gcctccaagctcgctgcctacaacaagaaatccaccatctccaccagagagattcagacc
tccgtccgtctcatcctgcccggtgaactggccaagcacgctgtctctgagggcaccaag
gccgtcaccaagtactcttcctctgcccgataa

DBGET integrated database retrieval system