KEGG   Trichophyton verrucosum: TRV_05810Help
Entry
TRV_05810         CDS       T01615                                 

Definition
(RefSeq) DUF207 domain protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
tve  Trichophyton verrucosum
Brite
KEGG Orthology (KO) [BR:tve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tve03016]
    TRV_05810
Enzymes [BR:tve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     TRV_05810
Transfer RNA biogenesis [BR:tve03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    TRV_05810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 9583904
NCBI-ProteinID: XP_003025844
UniProt: D4DF65
AA seq 341 aa AA seqDB search
MASIPSSFTSKKEKILRDLSVPEEDYTDLSPKGSVDVAIIPLIRDINRLPGLVTTSSCAG
RISVFVERGKGGKVQADITAPGTERALDGRENTSSEDKPGHDKHIRTEYVNKFVPKGGKG
SGTWQFVSHDPLIFDEEKTDKSLHELFGLKPSRTAINPSGNGEIQLVKFKFEPMILHIMA
ASLSHAQPVLAAASNAGFRESGLQGLRCLEDPEACPIVAVRSSGLGLESIIGYIENDGSP
EAIARSFVTEEYLQLLVQISNERFAVNTERMERFRVKLLHVGGGQALGNPNLQWEDPIAR
RARKRAEGLERGKAAKEARKPENLASVTDDDMIFGVNTLDI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcctccataccttctagtttcacctctaaaaaggagaagatactaagggacctgtct
gtccctgaagaagactatacagatttatcccccaagggctcggtggatgttgcaattata
cctcttatacgggacatcaaccggctgccgggccttgtgacgacgagcagctgcgctggg
cgcatcagtgtgttcgtcgaacgaggaaagggaggcaaggtccaggctgatatcactgcc
cccggcactgagagggcccttgacggccgtgaaaacacctcttcagaagataaacccggt
catgataagcatataaggacagaatatgtgaataaattcgttcctaaggggggaaaaggc
agcggaacatggcaatttgtctcccatgaccccctgatattcgatgaagagaaaacggac
aagagtctgcatgaactatttggactgaagccatcgaggaccgcaataaacccaagtgga
aacggcgaaatacaactggtcaaattcaaattcgagcctatgattctccatataatggct
gcatctctgagccatgcccagcctgtccttgctgctgccagtaatgcaggcttcagagaa
agtggactccagggccttcgatgcctcgaggacccggaagcatgtcctattgtcgctgta
cgatcttccggcctaggacttgagtcaatcataggctatattgaaaacgatggttcacct
gaagccatagcccgtagtttcgtaaccgaagagtatttgcagttgcttgttcaaatttcg
aatgaacggtttgcagttaacacagagcgcatggaaagatttagggtgaaactcttgcat
gtaggtggagggcaagcgcttggtaaccctaacctgcaatgggaggacccaatagctagg
agagcaagaaagagagcggaagggctggaaaggggcaaagctgcgaaagaagcacgaaag
ccagaaaatttggcttcagtgacagatgatgatatgatatttggagttaatactctagac
atataa

DBGET integrated database retrieval system