KEGG   Trichophyton verrucosum: TRV_06128Help
Entry
TRV_06128         CDS       T01615                                 

Definition
(RefSeq) coenzyme A transferase, putative
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
tve  Trichophyton verrucosum
Pathway
tve00072  Synthesis and degradation of ketone bodies
tve00280  Valine, leucine and isoleucine degradation
tve00650  Butanoate metabolism
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TRV_06128
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TRV_06128
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRV_06128
Enzymes [BR:tve01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     TRV_06128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-GeneID: 9584591
NCBI-ProteinID: XP_003019840
UniProt: D4DG26
AA seq 518 aa AA seqDB search
MPFHAAKTCLRTAGRFTANPASSQHFLVRAFSSTVARFEINKVYPSAKEAIKDMKSNSTV
LAGGFGLCGIPGTLINEIHSTPSITGLTAVSNNAGIDGAGLGLLIASGQIKKMIASYVGE
NKSLEQKYLSGEIELELTPQGTLAERCRSGGAGIPAFYTPAAFGTVVQTGDLAVKNNPDG
SVATYGTPRDVKVFDGKSYVMEESIKGDYALVKAWKADKLGNCQFRYSAANFNGAMGRNA
KITIVEAENIVEVGEIDPAAVHLPGIYVKRVIQSKAEKQIERLTFAKENEDTAALGKGET
ASKRERIVRRAAKEFKNGMYANLGIGMPMLAPSFVDPSVEVQLQSENGILGLGPYPKEGQ
QDADLINAGKETVTLLPGASIFGSEESFGMIRAGRIDLTILGAMQVSAKGDLANWMLPGK
VKGFGGAMDLVSNPTATKVVVTMEHTDKKGNPKILKQCEFPLTGRACVSRIITELCVFDV
DFANGLTLIELADGVTVEEVRSKTEAPFKVADDVKPML
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcacgctgcaaagacctgcctccgcacggcggggaggttcactgctaaccca
gcatcaagccaacacttcctcgttcgtgccttttcgagcaccgttgctcgattcgagatc
aacaaggtctacccctctgccaaagaggcgatcaaggacatgaagtccaactcgaccgtg
ctggctggtggattcggtctttgtggtattcctggcaccctgatcaatgagattcactct
actccttccatcactggcttgactgctgtcagcaacaatgccggtatcgatggtgcgggg
cttggtcttctgattgccagcggacagatcaagaagatgattgccagctacgttggagag
aacaagtctcttgagcaaaagtacctttctggagagattgagctggagcttactcctcag
ggtacccttgctgagcgttgccgatctggcggtgctggtatccccgccttctacacccca
gctgcctttggcaccgttgttcagaccggtgaccttgctgtgaagaacaacccggatgga
tctgttgccacctacggaaccccaagagacgtcaaggtcttcgatggcaagagctatgtt
atggaagagtccatcaagggagactatgcgctggtcaaggcttggaaggcagacaagctt
ggaaactgccagttccgatactccgctgccaacttcaacggtgccatgggccgtaacgca
aagatcaccattgtcgaggctgagaacatcgttgaggtcggcgagattgacccagctgcc
gtccaccttcccggtatctacgtcaagcgtgtcatccagagcaaagccgagaagcagatt
gagagactcactttcgctaaggagaatgaggataccgccgctctcggcaagggcgaaacc
gccagcaagagagagcgcattgtacgccgtgcggctaaggagtttaagaacggaatgtac
gcaaacttgggtatcggtatgcccatgcttgctcccagcttcgttgacccatcagtcgaa
gtccagcttcagtctgagaacggtatcctcggtcttggaccttaccccaaggagggccag
caggatgctgacctgatcaacgcgggcaaggagactgtcactcttctccctggcgcctcc
atcttcggaagtgaagagtcttttggaatgatccgagctggacgtattgacttgactatc
cttggtgccatgcaggtcagcgccaagggagatttggccaattggatgcttccaggtaag
gtcaagggcttcggaggagccatggatctcgtctccaaccctaccgccactaaagtcgtc
gtcaccatggaacataccgataagaagggcaaccccaagattctcaagcagtgcgagttc
ccactcactggccgagcttgtgtcagccgaatcatcaccgaactctgcgtctttgatgtt
gatttcgccaacggccttactctgatcgagttggctgatggcgttaccgttgaggaagtc
cgctccaaaaccgaagctcccttcaaggtagctgatgacgttaagccaatgttgtaa

DBGET integrated database retrieval system