KEGG   Trichophyton verrucosum: TRV_06961Help
Entry
TRV_06961         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00630  Glyoxylate and dicarboxylate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01200  Carbon metabolism
Module
tve_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TRV_06961
Enzymes [BR:tve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TRV_06961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9582110
NCBI-ProteinID: XP_003018950
UniProt: D4DIF3
AA seq 596 aa AA seqDB search
MLRSVSRQLPRALRKPTPAFPTIRCISSTSLRMAPQLPAVRPPVSSALPADSYQLLSTAE
KAGAAEDALFEEQIKAVNEWWASDRYEGIKRPYSAEAVVSKRGALQQTYPSSLMARKLFN
LLNERAAEGKPVHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTSTNEVSPDFGDYPYN
TVPNQVQRLFKAQNMHDRKHWDARRKLSPEERKNTPYIDYMRPIIADGDTGHGGLTAVMK
LAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDIMGTENLLI
ARTDSESGKLLSSTIDVRDHEFILGVTEDGDPLAETLQKMELEGASGAEIDVYEAQWVKK
HKLVTFDEAVDQHLIAEGASESVRNEYKSHVEQNRDLSISARRELAAKYTKNPVFWSWDI
PRTREGFYHYRAGNEAATKRAIAFAPYADLLWVETGDPNVSKAADFAGKIRKQFPGKKLV
YNLSPSFNWMGQGFTEQTLKSFIWDLAEHGFILQLISLAGLHYNATMATELSRGFKEDGM
LSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGIVGSILSGSSSNKSMGEGNTEDRK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctcagtgtcacgccagctgccgcgagctctccgcaagccgacacccgcattc
cccacgatccgctgcatctccagcaccagcctgcgaatggccccccagctacccgctgta
cgccctcccgtctcatcggcgcttccagcagactcatatcagctcctatcgaccgctgag
aaagctggtgctgccgaagatgccctgtttgaagagcaaatcaaggccgtaaacgagtgg
tgggcatccgacagatatgagggtatcaagaggccatactccgctgaggcggtggtgagc
aagcgaggagctttgcaacagacatatcccagctcgttgatggcgaggaaactcttcaac
ttgctgaacgaacgagctgcggagggcaaaccagtccacactctgggagcaattgacccc
gtacagatgacccaacaagcaccaaaccaggaggtgctttatatatcaggatgggcatgc
tcatcgcttcttacctccacgaacgaagtctcgccggactttggagactacccatacaac
accgtgccaaatcaggtacaacgcctgttcaaggcccagaacatgcacgacaggaaacat
tgggatgccaggcgaaagctctcgccagaagagcgcaagaataccccatacatcgattac
atgcgccctattattgcagatggtgatactgggcacggcggcctcaccgcagtcatgaaa
ctagccaaattgtttgccgagaacggcgccgcagccgtacactttgaggatcaattgcac
ggcggcaagaagtgtggtcatcttgctggcaaggttctcgtaccgattgcggagcatatt
aacagattggttgcggcccggttccagtgggatattatgggcaccgagaaccttcttata
gcacgaacagattcagagagtggtaagttgctgagcagcactatcgacgtgcgggatcac
gaatttatcctcggtgtgacggaggacggtgaccccttggccgagacgctccagaaaatg
gagttggagggcgcatctggcgcagagatcgatgtttacgaagcccagtgggttaagaaa
cataaactggttacattcgatgaagccgtggaccaacacctcatcgctgaaggtgcctct
gagtcagttagaaatgaatataaatcgcatgttgagcagaaccgtgatctttcgatctct
gctcgccgggagttggcagccaaatacacaaagaaccccgtcttctggtcctgggacatc
ccacgcacccgcgaaggcttctatcattaccgtgctggcaatgaggcagctaccaagcgt
gctattgcatttgccccctatgcagacctcctgtgggttgagaccggagaccccaacgtt
agcaaagctgccgactttgctggcaagatccgcaaacaattccctggcaagaagttggtg
tacaacttgagcccctcgttcaactggatgggacaaggattcaccgagcagacccttaaa
tcatttatttgggatttggcagagcacggattcattctccaacttatctccctcgctggt
ctgcactacaatgccacaatggctactgagctgtctcgtggattcaaggaagatggcatg
ctatcttacgtcaatttggtgcagaaacgcgaaaaggagatgggtgttgatgtacttaca
catcagaaatggagcggagcgccgtatgtcgacggtattgtgggatctatcctcagcggt
agcagctcaaacaagagcatgggtgaaggaaacactgaagaccgtaagtaa

DBGET integrated database retrieval system