KEGG   Trichophyton verrucosum: TRV_07169Help
Entry
TRV_07169         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tve  Trichophyton verrucosum
Pathway
tve00270  Cysteine and methionine metabolism
tve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TRV_07169
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     TRV_07169
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     TRV_07169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-GeneID: 9581369
NCBI-ProteinID: XP_003018809
UniProt: D4DJ04
AA seq 171 aa AA seqDB search
MRAYWFDDAEGDQRAPHDSGRAVDTDYLARIGVLYKKCPSVDDVNALASERGYKNRDEIT
VSPEKMGAVYEEKVKSFFDEHLHEDEEIRYILDGEGYFDVRSRDDKWVRIKVEKEDLLIL
PAGIYHRFTTGESNYIKAMRLFQDEPKWTPLNREPALDNNSFRQSYVAAHV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgtattggttcgacgacgctgagggcgaccagcgcgcacctcatgactcaggc
cgtgctgttgacacagactacctcgctagaataggtgttctatataagaaatgcccttca
gttgacgacgtcaacgccctggcttcggagcggggttataagaaccgcgatgagataaca
gtctctcccgagaagatgggtgcagtctacgaggaaaaagtgaagtcattcttcgatgag
caccttcatgaagatgaggagattaggtacattctggatggcgaaggatatttcgatgtt
cgcagcagagacgacaagtgggtgcggattaaagttgagaaggaggacctacttatcttg
cctgccggaatataccatcgcttcacgacgggagagagcaattatatcaaagcgatgagg
ttgttccaggatgagccgaaatggacgcctttgaaccgcgaaccagcgcttgataacaat
tcgttcagacagagctatgttgctgcccatgtgtaa

DBGET integrated database retrieval system