KEGG   Trichophyton verrucosum: TRV_08055Help
Entry
TRV_08055         CDS       T01615                                 

Definition
(RefSeq) carboxypeptidase S1, putative
  KO
K13289  cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
tve  Trichophyton verrucosum
Brite
KEGG Orthology (KO) [BR:tve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tve01002]
    TRV_08055
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tve03110]
    TRV_08055
   04131 Membrane trafficking [BR:tve04131]
    TRV_08055
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tve04147]
    TRV_08055
Enzymes [BR:tve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     TRV_08055
Peptidases [BR:tve01002]
 Serine Peptidases
  Family S10
   TRV_08055
Chaperones and folding catalysts [BR:tve03110]
 Intramolecular chaperones
  Other peptidases
   TRV_08055
Membrane trafficking [BR:tve04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    TRV_08055
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRV_08055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S10 Carbpep_Y_N
Motif
Other DBs
NCBI-GeneID: 9579811
NCBI-ProteinID: XP_003017935
UniProt: D4DLI1
AA seq 543 aa AA seqDB search
MKFLTTGLLATAALAAAQEQHVLQAEDGHGQAPQRDASIFDETLQKFQSSLEDGISHFWS
EMKTNFKDYLPLISLPKKHTRRPDSEWDHVVRGADIESVWVQGADGEKRREIDGKLHNYD
LRVKAVDPSKLGVDPGVKQYSGYLDDNDADKHLFYWFFESRNDPKNDPVVLWLNGGPGCS
SLTGLFLELGPATIDKNLKVVSNPYSWNSNASVIFLDQPVNVGFSYSGSSVSDTVAAGKD
VYALLTLFFKQFPEYASQDFHISGESYAGHYIPVFAAEILSHKNTNINLKSALIGNGLTD
PLTQYPQYRPMACGEGGYPAVLDQGTCRSMDNSLERCLSLIETCYSSESAWVCVPAAMYC
NSAILAPYQQTGMNPYDVRTKCEDMASLCYPQLNAITKWLNQESVMQALGVEVQSYESCN
SGINRDFLFHGDWMKPYHRLVPSVLEKIPVLIYAGDADFICNWLGNLAWTDALEWPGHKK
FAEAKLEDLKIVNNKDKGKKIGQVKSSGNFTFMRIFGAGHMVPLNQPEASLEFFNRWLGG
EWH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttaccaccggccttctggccaccgctgccctcgcggccgcccaggagcag
catgtcctccaggcagaagacggccatggccaggctccccagcgagacgcctccatcttc
gacgagaccctccagaagttccagtccagcctggaggatggcatctcccacttctggtcc
gagatgaagaccaacttcaaggactacctccctctgatctcgctgcccaagaagcacacc
cgccggcctgactcagaatgggaccatgtcgtccggggagcggacatcgagagcgtctgg
gtccagggagccgatggcgagaagcgccgcgaaatcgacggcaagctccataactacgac
ctccgagtcaaggctgtcgacccttctaagctgggtgtcgaccccggcgtcaagcagtac
agcggctacctcgacgacaacgatgctgacaagcacttgttctactggttctttgagtct
cgcaacgaccccaagaacgatcccgtcgtgctctggctcaacggcggcccaggctgctct
tccttgaccggcctgttcctcgagctgggcccggccaccatcgacaagaacctcaaggtc
gtcagcaacccttactcttggaactccaacgcttccgtcatcttcctggaccagccagtc
aacgttggcttctcctacagtggttcgtctgtttccgacaccgttgctgccggaaaggac
gtctacgccctcttgaccctgttcttcaagcagttccccgaatatgcctcccaggacttc
cacatctccggtgaatcctatgccggacactacatcccagtctttgctgccgagattctg
tcccacaagaacaccaacatcaacctcaagtccgccctcatcggcaacggattgactgac
cccttgacccagtaccctcagtaccggcctatggcctgcggcgagggcggctaccctgct
gttttggaccaaggcacttgccgctccatggacaactcgcttgagcgttgtctttccctg
atcgagacctgctacagctccgagtccgcttgggtgtgtgtccccgctgccatgtactgc
aacagcgccatcctcgctccttaccagcagaccggcatgaacccctatgacgtccgcacc
aagtgtgaggacatggcatctctctgctacccccagcttaacgccatcaccaagtggctc
aaccaagagtctgtcatgcaggcccttggtgtcgaggtccagtcctacgagagctgcaac
agcggcattaaccgtgacttcctcttccacggtgactggatgaagccataccaccgtctc
gtccccagcgtgctcgagaagatcccagtcctcatctacgccggtgatgccgacttcatc
tgcaactggctcggcaacctggcctggaccgacgctcttgaatggcccggccacaagaag
tttgctgaagccaagctggaagatctcaagatcgtgaacaacaaggacaagggcaagaag
atcggccaggtcaagtccagcggcaacttcactttcatgcgtatctttggcgccggccac
atggtgccacttaaccagcccgaagccagtttggagttcttcaaccgttggctcggaggc
gaatggcactag

DBGET integrated database retrieval system