KEGG   Thiocystis violascens: Thivi_1571Help
Entry
Thivi_1571        CDS       T02138                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tvi  Thiocystis violascens
Pathway
tvi00630  Glyoxylate and dicarboxylate metabolism
tvi00710  Carbon fixation in photosynthetic organisms
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01130  Biosynthesis of antibiotics
tvi01200  Carbon metabolism
Module
tvi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Thivi_1571
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thivi_1571
Enzymes [BR:tvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Thivi_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFL73560
UniProt: I3Y992
Position
1713190..1713546
Genome map
AA seq 118 aa AA seqDB search
MSEMQDYPSSLEDVNSRKFETFSYLPAMEADKIRKQVEYIVAKGWNPAVEHTEPENAFDH
YWYMWKLPMFGETNVDTILAEAEACHKAHPNNHVRLIGFDNYAQSKGAEMVVFRGKPV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgcaggactacccatccagtctcgaagacgtcaacagccgcaagttcgag
accttctcctatctgcccgcgatggaggcggacaagatccgcaagcaggtcgagtacatc
gtcgccaagggctggaatccggcggtcgagcacaccgagccggaaaacgccttcgaccac
tactggtacatgtggaaactgccgatgttcggcgagaccaatgtcgacaccatcctggcc
gaggccgaggcatgccataaggcgcaccccaataaccatgtgcgtctgatcggcttcgac
aactacgcccagtccaagggcgccgagatggtggtgttccgcggcaaaccggtctga

DBGET integrated database retrieval system