KEGG   Thiocystis violascens: Thivi_2831Help
Entry
Thivi_2831        CDS       T02138                                 

Definition
(GenBank) glycyl-tRNA synthetase beta chain
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
tvi  Thiocystis violascens
Pathway
tvi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thivi_2831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tvi01007]
    Thivi_2831
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tvi03016]
    Thivi_2831
Enzymes [BR:tvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Thivi_2831
Amino acid related enzymes [BR:tvi01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Thivi_2831
Transfer RNA biogenesis [BR:tvi03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Thivi_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AFL74747
UniProt: I3YCM9
Position
complement(3107512..3109590)
Genome map
AA seq 692 aa AA seqDB search
MDTFADLLIEIGTEELPPKALPNLSKAFAENFLLQLKAHGIEYETIERFTTPRRLALLVR
KIGRHQPDQSIQRRGPALQAAFHADGQPTPAALGFARSCGVEIDALGRDVTEKGSWLAFR
VLQPGLETAQLVPSMCEAALADLPIPKRMRWGDREEEFVRPVQWVCLMLDDARIAGSILG
VEADADTRGHRFHHPDRIGLSSASDYPESLRSMGYVEASFERRRDLIRDQVNLLASTHGL
KARIDADLLDEVTALVEWPQALLCRFDTRYLEMPPEVLIETMQSHQKYFPVVDDAGVLQD
AFIAVANIVSRDPDQVRAGNERVIRPRFSDAAFFWSKDLTQPLSAFADRLETLVFQEKLG
TMAEKSRRVACLGRYLAPMLMSDPDLIARAAQLAKCDLVSSMVFEFPGLQGIMGRYYAEK
SNEDPCVSHALEEQYLPRFAGDDLPASACGKVLAIADRVDTLVGIFGIGLRPTGTRDPYA
LRRASIAVLRLMIETSIDLDLRDLLKVAANCYAPGTLSDDTVETVLAYMLDRLHGYYADR
GVAVDTVDAVIESRVTNPWDLDRRIAAVSSFRMLPAADFLATANKRIHNILSKNAVDSGD
AGSVDPALLTDPAEIRLAARIDELSQACGPLAARHDYIGILETLAGLTNEIDTFFSDVMV
MSEDDRVRQNRIRLLRSLAGLFMLVADISRLH
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
ttggacacatttgctgatctgctgattgagatcggaaccgaggaacttccgccgaaagcc
ttgccgaatctgtccaaggcgtttgccgagaattttctgctccagttgaaggcgcacggg
atcgaatacgagacgatcgagcggtttacgacgccaaggcgtcttgcgctcctggtgcga
aagattggcagacaccagcctgaccagagcattcaacggcgtggacctgccttacaggcg
gcttttcatgcggatggtcaaccgacgccggccgcccttggattcgcccgctcctgcggt
gtcgagatcgatgcgttaggccgggacgttaccgaaaaaggctcctggctcgcgtttcgc
gtgttgcagccgggtcttgagacggcgcaattagtcccttcaatgtgcgaggccgcgctg
gcggatcttcccatcccgaaacggatgcgttggggagatcgcgaagaggaattcgtcaga
ccggtgcaatgggtttgcttgatgctggatgacgcgcggatcgcgggttctatccttggc
gtggaagcggatgccgataccagagggcatcgctttcatcatcccgacaggatcggcctg
tcttccgcttccgattaccctgagtcgctacgctcgatgggttatgtcgaggcgtcattc
gagcgccgacgtgacctgattcgcgatcaggtcaatcttctggcgtcaacgcatggcctc
aaggcacggatcgacgctgatttgctggatgaggtgacagcccttgtggaatggcctcag
gcattgctgtgtcgtttcgacacgcgctaccttgagatgccgccggaagtactgattgag
accatgcaaagccaccagaaatattttccggtcgtggacgatgctggtgtgcttcaggat
gcgtttattgccgtcgccaacatcgtcagccgcgatccggatcaggtgcgcgccggtaat
gaacgtgtcattcgacctcggttttcggatgcggcattcttctggtcaaaagatttgacg
caacctctcagcgcctttgccgatcggcttgaaacgcttgtgttccaggaaaagcttggg
accatggctgaaaaaagccgtcgcgttgcctgtctcgggcgctatcttgccccgatgctc
atgagcgatcccgatctgatcgcgcgagcggctcaactggccaaatgcgatcttgtgtcg
tcgatggtctttgagttccctgggctccaaggcattatggggcgttactacgcggaaaaa
tccaatgaggatccatgcgttagtcatgccttggaagagcaatatctgccgcgcttcgcg
ggcgatgacttgcccgccagcgcctgcggcaaagtgttagccatcgctgatcgtgtcgat
acgctcgtcggcatcttcggaatcggcctgcgaccgaccggtactcgcgacccttatgcg
cttcggcgcgcctccatcgcggtcttgcggctgatgatcgaaacctcgatcgatctcgat
ctccgtgatcttctgaaggttgccgccaattgttatgctccaggaacgctgagcgacgac
actgtcgaaacggtccttgcgtatatgctggaccgtctgcacggttattatgccgaccgt
ggagtggcggtcgataccgttgatgccgtgattgaaagtcgcgttacgaatccttgggat
ttggatcgacggatcgccgcggtttcttctttcagaatgctgccagcggccgatttcctg
gccacggcgaataaacgcatccacaacatcttgagcaagaacgctgtcgatagcggtgac
gcggggtccgttgatccggcattgctgaccgatcccgcggaaatccggctagcggcccgt
atcgacgaattgagtcaagcgtgtggcccccttgccgctcgtcatgattacatcggcatc
ctggagacactcgccggcctgacaaatgagatcgatacattcttctccgatgtgatggtg
atgtccgaggacgaccgcgtgcgtcaaaatcgaattcgactgcttcggtccctggcggga
ctgtttatgctggttgccgacatttcccgccttcactga

DBGET integrated database retrieval system