KEGG   Thiocystis violascens: Thivi_3353Help
Entry
Thivi_3353        CDS       T02138                                 

Definition
(GenBank) protein containing C-terminal region/beta chain of methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tvi  Thiocystis violascens
Pathway
tvi00450  Selenocompound metabolism
tvi00970  Aminoacyl-tRNA biosynthesis
tvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Thivi_3353
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thivi_3353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tvi01007]
    Thivi_3353
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tvi03016]
    Thivi_3353
Enzymes [BR:tvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Thivi_3353
Amino acid related enzymes [BR:tvi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Thivi_3353
Transfer RNA biogenesis [BR:tvi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thivi_3353
 Prokaryotic type
   Other AARSs
    Thivi_3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFL75223
UniProt: I3YE05
Position
complement(3666785..3668833)
Genome map
AA seq 682 aa AA seqDB search
MSKPRDILITSALPYANGPIHIGHLVEYIQTDIWARFQKMRGHHCWYVCADDAHGTPIML
RARQESIAPEALIARVAAEHQADFADFRVGFDNYHSTHSPENQHFATLIYERNRDAGHIA
KRTITQAYDPVERMFLPDRFIKGECPKCGAADQYGDNCEVCGASYSPAELKNPRSAVSGA
VPEQRESDHYFFRLGDFEEMLRVWTRGGLQKEVANKLDEWFDAGLQEWDISRDAPYFGFE
IPDHPGKFFYVWLDAPIGYLASFKNLCDRTEGLDFDHYWGKDSTAELYHFIGKDIIYFHA
LFFPAMLHGAGFRTPSAIFAHGFLTVDGQKMSKSRGTFIKARTYLDHLNPEYLRYYFAAK
LGPGVDDIDLNLEDFTARVNADLVGKVVNIASRCAGFIGKRFAGRLSGALSESALFAEFV
QAGDAIADAYERREFSRAVREIMALADRANQYIDEKAPWVVAKQPVRDAELQDICSMGLN
LFRLLIGYLRPILPGTAVDAEAFMRIEPLTWAALAEPLLDHEIAPFTPLMTRVEPTRIAA
MLEASKEDLSVTGATATAAVPDEPNPHLTRDPIADPVDYETFAKTDLRIARIREAKWVEG
ADKLLQLTLDLGGETRNVFAGIRSAYDPKDLEGRLTVMVANLAPRKMRFGISEGMVLAAG
PGGKDLFILSPDSGAEPGMKVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcctcgcgacatcctcatcaccagcgccctgccctacgccaatgggccgatc
catatcggtcatttggtcgaatatatccagaccgacatctgggcgcggtttcagaagatg
cgcggtcatcattgctggtatgtgtgcgccgacgacgcgcacggcacgccgatcatgctg
cgcgcgcgtcaggagagcattgcacccgaggcactcatcgcgcgcgtcgccgcggaacat
caggccgatttcgcggacttccgggtcggtttcgacaactatcattccacccattcgccc
gaaaatcagcacttcgccacgctcatctacgagcgtaaccgggacgcgggacacatcgcc
aaacggacgatcacccaagcctatgacccggtcgaacggatgtttctgcccgaccgtttc
atcaagggcgaatgtcccaaatgcggcgcggcggatcagtacggcgacaactgcgaggtc
tgcggggcgagctactcgcccgccgagctgaaaaatccgcgctcggcggtctcgggcgcg
gtgcccgagcagcgcgaatccgatcattatttcttccggctgggcgatttcgaggagatg
ctgcgggtctggacccgtggcggcctgcaaaaagaggtcgccaacaagctcgacgaatgg
ttcgacgccggactccaggagtgggacatctcgcgcgacgcgccctatttcggcttcgag
atccccgatcatccgggcaagtttttctatgtctggctggacgcgcccatcggctatctg
gcgagcttcaagaatctctgcgaccgcaccgaggggctggatttcgaccattactggggg
aaggattcgaccgccgagctgtatcacttcatcggcaaggacatcatctatttccacgcg
ctgtttttccccgccatgctccacggcgcgggcttccgtaccccgagcgccatcttcgcc
cacggctttctcaccgtagacggacagaaaatgtccaagtcgcgcggcaccttcatcaag
gcgcggacctatctggatcacctcaaccccgaatatctgcgttactacttcgccgccaag
ctggggccgggcgttgacgacatcgatctgaacctggaggacttcaccgcgcgggtcaac
gcggacctggtcggcaaggtggtcaatatcgccagccgctgcgccggtttcatcggcaag
cggttcgcaggccggttgtcgggcgccttgtcggaatccgcgctgttcgccgagttcgtc
caggccggcgacgccatcgccgacgcctatgagcggcgcgaattcagccgcgcggtgcgc
gagatcatggccctggccgaccgcgccaatcagtacatcgacgagaaagcaccctgggtg
gtcgcgaaacagccggtgcgggatgccgagttgcaggatatctgttccatggggctcaat
ctgttccggctcctgatcggctatctgcgccccatcctgcccggcaccgcagtcgatgcc
gaggcgtttatgcggatcgagccgctgacctgggcggcgctcgccgagccattgctggac
cacgagatcgcgcccttcacgccgctcatgacccgcgtcgagccgacccggatcgcggcc
atgctggaggcatcgaaagaagatctgagcgtcacgggcgcgaccgcgaccgcagccgtg
ccggacgaacccaatccgcacctgacgcgcgaccccatcgccgacccggtcgattacgag
accttcgccaaaaccgatctgcggatcgcgcgcatccgcgaggcaaaatgggtcgagggc
gccgacaagctgctgcaactcacgctcgatctgggcggcgagacccgcaacgtcttcgcc
ggaatccgctcggcctatgatcccaaagatctggaagggcggctgacggtgatggtcgcc
aacctggccccgcgcaagatgcgcttcggcatctccgagggcatggtgctggccgccgga
ccgggcgggaaagatctcttcatcctcagcccggacagcggcgccgagccggggatgaag
gttaaatag

DBGET integrated database retrieval system