KEGG   Thiocystis violascens: Thivi_3439Help
Entry
Thivi_3439        CDS       T02138                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tvi  Thiocystis violascens
Pathway
tvi00071  Fatty acid degradation
tvi00280  Valine, leucine and isoleucine degradation
tvi00310  Lysine degradation
tvi00362  Benzoate degradation
tvi00380  Tryptophan metabolism
tvi00620  Pyruvate metabolism
tvi00630  Glyoxylate and dicarboxylate metabolism
tvi00640  Propanoate metabolism
tvi00650  Butanoate metabolism
tvi00900  Terpenoid backbone biosynthesis
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01130  Biosynthesis of antibiotics
tvi01200  Carbon metabolism
tvi01212  Fatty acid metabolism
tvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thivi_3439
   00630 Glyoxylate and dicarboxylate metabolism
    Thivi_3439
   00640 Propanoate metabolism
    Thivi_3439
   00650 Butanoate metabolism
    Thivi_3439
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Thivi_3439
   00072 Synthesis and degradation of ketone bodies
    Thivi_3439
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Thivi_3439
   00310 Lysine degradation
    Thivi_3439
   00380 Tryptophan metabolism
    Thivi_3439
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thivi_3439
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Thivi_3439
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thivi_3439
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvi04147]
    Thivi_3439
Enzymes [BR:tvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Thivi_3439
Exosome [BR:tvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thivi_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFL75309
UniProt: I3YE91
Position
complement(3757486..3758670)
Genome map
AA seq 394 aa AA seqDB search
MSENIVIVAAGRTAVGTFGGGLSALPATELGAVVLKALMERTGIAPEQIDEVILGQVLTA
GVGQNPARQTTLNAGLPQQVPAMTINKVCGSGLKAVHLAMQAVACGDADIVIAGGQESMS
QSSHVLPRSREGQRMGDWQLKDTMIVDGLWDAFNQYHMGVTAENIAKQYAFTREAQDAFA
AASQQKAEAAIKSGRFVDEIIPVSIPQRKGDPLVCATDEFPRPGTTAETLGKLRPAFDKE
GTVTAGNASGINDGAAMVVVMKESKAKELGLTPMARLVAFASAGVDPAIMGTGPIPASTK
CLEKAGWTPADLDLIEANEAFAAQAMSVNQDMGWDLSKVNVNGGAISIGHPIGASGARIL
VTLLYEMQKRDAKKGLATLCIGGGQGVALAVERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaatatcgtgatcgttgccgcgggtcgcaccgcggtcggcacctttgggggc
ggtctttccgccctccccgccaccgaactgggcgccgtcgtgctcaaggcactgatggag
cgtacagggattgccccggagcagatcgacgaggtcatcctgggacaggtgctgaccgcc
ggcgtcggccagaacccggcgcgccagaccaccctgaacgcgggtctgccccagcaggtt
ccggccatgaccatcaacaaggtctgcggcagcgggctcaaggcggttcatctggccatg
caggcggtcgcctgcggcgacgcggacatcgtgatcgccggcggtcaggaaagcatgagt
cagtcctcgcacgtcctgccgcgttcgcgcgagggtcagcgcatgggcgactggcagttg
aaggacaccatgatcgtcgacggtctctgggatgccttcaatcagtaccacatgggcgtc
accgccgagaacatcgccaagcaatatgcctttacccgcgaggcgcaggacgcctttgcc
gccgcctcgcaacagaaggccgaggccgccatcaagtccggtcgcttcgtcgacgagatc
attccggtgagcatcccccagcgcaagggcgatccgctggtctgcgccaccgacgaattt
ccgcgtcccggcaccaccgccgagaccctgggcaagctgcgtcccgccttcgacaaggaa
ggcaccgtgaccgccggcaatgcctcgggcatcaatgacggcgcagccatggtcgtggtc
atgaaggagtccaaggccaaggaactgggtctgaccccgatggcccgtctggtcgccttc
gcgagcgctggcgtcgatcccgccatcatgggcaccggcccgattccagcctccaccaaa
tgtctggaaaaggccggctggaccccagccgatctggatctgatcgaggccaacgaagcc
ttcgccgcccaggcgatgtcggtgaatcaggacatgggctgggatctgtccaaggtcaat
gtcaacggcggcgccatttccatcggccatccgatcggcgcctccggcgcgcgcatcctg
gtcaccctgctctatgagatgcagaagcgcgatgccaagaagggtttggcaacgctgtgc
atcggcggcggacagggtgtcgccctggcggtcgagcgtctctga

DBGET integrated database retrieval system