KEGG   Thiocystis violascens: Thivi_3909Help
Entry
Thivi_3909        CDS       T02138                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tvi  Thiocystis violascens
Pathway
tvi00010  Glycolysis / Gluconeogenesis
tvi00051  Fructose and mannose metabolism
tvi00562  Inositol phosphate metabolism
tvi00710  Carbon fixation in photosynthetic organisms
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01130  Biosynthesis of antibiotics
tvi01200  Carbon metabolism
tvi01230  Biosynthesis of amino acids
Module
tvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tvi_M00002  Glycolysis, core module involving three-carbon compounds
tvi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thivi_3909
   00051 Fructose and mannose metabolism
    Thivi_3909
   00562 Inositol phosphate metabolism
    Thivi_3909
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thivi_3909
Enzymes [BR:tvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thivi_3909
Exosome [BR:tvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thivi_3909
  Exosomal proteins of bladder cancer cells
   Thivi_3909
  Exosomal proteins of melanoma cells
   Thivi_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFL75746
UniProt: I3YFH8
Position
4256873..4257637
Genome map
AA seq 254 aa AA seqDB search
MRQPLIAGNWKMNGTRASAEALLSGVVAGASTISKTEIVVCPPFPFLSLGERLLSGASVK
LGAQNVCTKDVGAYTGEVSAAMLAEFGCCYVICGHSERREYYGETDAIIAEKLTACASQG
MIPILCVGETLQQREQGLTEDVIAGQLDGVISQIGIDAFHQAEIAYEPVWAIGTGMTATP
EQAQDVHAFIRQRIAERSQTIAEKIRILYGGSMKAANARDLLSQADIDGGLIGGASLVAA
DFLAICQAGDLVAG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagccattgatcgcgggaaactggaaaatgaacggcaccagggcgagcgccgaa
gcgctgttgtctggtgtggttgctggcgcgtcgacgatctccaaaacggaaatcgtggtt
tgcccgccgtttccgtttctgtctctcggtgaacgattgctttccggcgcgtcggtgaaa
ctcggcgcgcagaatgtctgcaccaaggatgtcggcgcctacacgggtgaagtgtccgcc
gctatgctggccgaattcggttgttgctatgtcatctgcggtcattccgagcgccgcgaa
tattatggcgaaacggacgcgatcatcgcggaaaagctgaccgcctgcgcgagtcagggt
atgatccccattctctgcgtcggcgaaaccctgcaacagcgtgagcagggactgacagaa
gacgtgattgccggtcagctcgacggtgttatcagtcaaattgggatcgatgcgttccat
caggccgagattgcctatgaaccggtctgggcgattggcacggggatgactgcgactccc
gagcaggctcaggatgtgcatgcgttcatccgtcagcggatcgcggaacgcagtcaaacg
attgccgagaagatccggattctctatggcggcagcatgaaagccgcgaatgcccgcgat
ctgctgtcgcaagccgatatcgatggaggcctgatcggtggagcttctctggttgctgct
gattttctagcgatctgtcaggctggcgatctggtggcgggctaa

DBGET integrated database retrieval system