KEGG   Thiocystis violascens: Thivi_4478Help
Entry
Thivi_4478        CDS       T02138                                 

Definition
(GenBank) protein-L-isoaspartate and D-aspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tvi  Thiocystis violascens
Brite
Enzymes [BR:tvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thivi_4478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 CMAS Methyltransf_32 Methyltransf_12 RrnaAD
Motif
Other DBs
NCBI-ProteinID: AFL76275
UniProt: I3YH07
Position
complement(4839785..4840519)
Genome map
AA seq 244 aa AA seqDB search
MKPLLLASLLCLAIGSGACARDDDMSDARNRLIEQIENEVRMTARELGVNGLDPRVADAL
RRVPRERFVPESERHLAYRNHPLPIGDGQTISQPYIVAIMSQLLAVGPGDRVFELGTGSG
YQAAVLAALGVEVYSVEIVPELAARAAATLAALGEDKVRVRAGDGWLGWPEAAPFDGIIV
TAAAPSLPRHLIDQLKPDGRLVIPMGGVDTIQQLALFEKDADGRLQRRNLIDVRFVPVTG
SMAP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccactccttctcgcgtcgctgctgtgtctcgccatcggaagcggcgcctgtgca
cgggacgacgacatgagcgatgcgcgcaaccggttgatcgagcagatcgaaaacgaggtt
cggatgaccgcgcgcgagttgggcgtcaacgggctcgatccccgggtcgccgacgccctg
cgccgggtaccgcgcgagcgtttcgtccccgagtcggaacgccatctcgcctatcgcaac
catccgctccccatcggcgacggacagaccatctcccagccctatatcgtcgccatcatg
agccaactgctggcggtcggcccgggcgatcgggtgttcgagctggggaccggttccggt
tatcaggccgccgtcctggccgccctgggcgtcgaggtctactcggtggaaattgtgccg
gaactggccgcgcgggccgccgcgacactcgcggcgcttggcgaggacaaggtccgggtg
cgcgcgggcgacggctggcttggctggcccgaggcggcccccttcgatggcatcatcgtc
accgccgccgcgccctcgttaccgcgccacctgatcgatcaactcaaaccggacggtcgg
ctagtgattccgatgggcggcgtcgacacgattcaacagttggcgctgttcgagaaggac
gcggacggacgcttgcaacgtcgcaacctgatcgatgtccgcttcgtcccggtgacggga
tccatggccccttga

DBGET integrated database retrieval system