KEGG   Thiocystis violascens: Thivi_4572Help
Entry
Thivi_4572        CDS       T02138                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tvi  Thiocystis violascens
Pathway
tvi00020  Citrate cycle (TCA cycle)
tvi00480  Glutathione metabolism
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01200  Carbon metabolism
tvi01210  2-Oxocarboxylic acid metabolism
tvi01230  Biosynthesis of amino acids
Module
tvi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thivi_4572
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Thivi_4572
Enzymes [BR:tvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Thivi_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFL76364
UniProt: I3YH96
Position
4952739..4953995
Genome map
AA seq 418 aa AA seqDB search
MAYEKIQIPATGEKIQVNADLSLNVPNQPIIPYIEGDGIGIDITPVMCSVVDAAVAKAYG
GSRQIQWMEIYAGEKSTRTYGEDVWLPDETLAAVKDFVVSIKGPLTTPVGGGIRSLNVTL
RQQLDLYVCLRPVRYFTGTPSPLKAPEHTDMVIFRENSEDIYAGIEWQEGTPEARKVIDF
LRNEMGVTKIRFPETSGIGIKPVSREGTERLVRKALQYVIDNDRPSLTLVHKGNIMKFTE
GAFKQWGYDLAKAEFGAVEIDGGPWCSFKNPKTGTEIVVKDVIADAFLQQILLRPKDYSV
IATLNLNGDYISDALAAQVGGIGMAPGANLSDSVAMFEATHGTAPKYAGKDQVNPSSLIL
SAEMMLRHMGWVEAADLIIKGVEGAIAAKTVTYDLDRLMDGATKLSCSGFGAAVVGKM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaaaaaatccagattccggcaaccggcgagaagatccaggtcaacgctgac
ctgtcgctgaacgtccccaaccagccgatcattccgtatatcgaaggcgacggcatcggc
atcgacatcacgccggtcatgtgctcggtggtcgatgcggcagtggcgaaagcctatggc
ggctcgcgccagatccaatggatggagatctacgccggcgagaagtcgacccgcacctat
ggcgaggatgtctggctgccggacgaaacgctcgcggcggtcaaggatttcgtcgtgtcg
atcaaggggccattgacgacgccggttggcggcgggatccgttcgctcaacgtcaccctg
cgtcagcaactggatctctatgtctgtctgcgcccggtgcgctatttcaccggtacgccg
agcccattgaaagcgcccgagcataccgatatggtgatcttccgcgagaattcggaagac
atctatgccggtatcgagtggcaggaaggcacgcccgaggcgcggaaggtcatcgacttc
ctccgcaacgagatgggcgtgaccaagatccgcttccccgagacctccgggatcggtatc
aagccggtctcgcgcgagggcacggaacgtctggtgcgcaaggcgctccaatacgtcatc
gacaatgaccgcccgtcgctgaccctggtgcacaagggcaacatcatgaagttcaccgag
ggtgccttcaagcagtggggctatgatctggccaaggcggaattcggcgcggtggaaatc
gacggcggcccctggtgcagcttcaagaatcccaaaaccgggaccgagatcgtcgtcaag
gacgtgatcgccgatgccttcctgcaacagatcctgctgcgcccgaaggactattccgtg
atcgcgaccctgaatctgaacggtgactatatctccgacgcgctggcggctcaggtcggc
gggatcggcatggcgcccggcgcgaatctgtccgattcggtggcgatgttcgaggcgacc
catggcaccgcgcccaagtatgccggcaaggatcaggtcaatcccagttcgctcatccta
tcggccgagatgatgttgcgtcacatgggttgggtcgaggcggccgatctgatcatcaag
ggtgtggagggcgcgatcgcggccaagaccgtgacctatgacctggatcgactgatggac
ggcgcgaccaagctgagttgctcgggctttggcgcggcggtggtcgggaagatgtag

DBGET integrated database retrieval system