KEGG   Thioalkalivibrio versutus: TVD_01520Help
Entry
TVD_01520         CDS       T03959                                 

Definition
(GenBank) ferredoxin-NADP reductase
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    TVD_01520
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TVD_01520
Enzymes [BR:tvr01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     TVD_01520
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     TVD_01520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6
Motif
Other DBs
NCBI-ProteinID: AKJ94127
UniProt: A0A0G3G3S4
Position
323475..324215
Genome map
AA seq 246 aa AA seqDB search
MGWVTGVVQERKQWTDRLFSLRVDAEVELFKAGQFNRLRLEIDGEPVARPYSYVNAPGET
PLDFYLITVPDGPLSNRLAQLGPGDTVELMPRATGFFTLDELPDSRDLWLLSTGTALGPF
LSMLKTDTPWERFENIRLIHAARKAEELTYQDTIRQFQERDAKRFQYIPFVSREPFPGGL
EGRVPAAIAEGRLEHHAGLKITPEHSQVMLCGNPDMVKDTAAILRERGLEKNRRRKPGQI
TTENYW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggtgaccggtgtcgtacaggagcgcaagcagtggacggatcgactgttctcg
ctgcgggtggatgccgaggttgagctgttcaaggccgggcagttcaaccgcctgcgtctg
gagatcgacggcgagccggtggcgcggccgtattcctatgtgaatgcgccgggcgaaacg
ccgctggacttctatttgatcaccgttccggatggaccgctgtccaatcgtctggcgcaa
ctggggccgggcgacacggtggagctgatgccgcgcgcgaccggcttttttaccctggat
gagctaccggacagccgcgacctgtggctgctttccacgggcactgcgctggggccgttc
ctgtccatgctgaagaccgataccccctgggaacgcttcgagaacatccgcctgatccac
gcggcgcgcaaggccgaagaactgacctatcaggacacgatccggcagttccaggaacgt
gacgcgaagcggttccagtacatcccgtttgtcagccgcgagccgttcccgggtgggctc
gagggccgggtaccggccgcgattgccgagggccgcctggagcatcacgcgggcctgaag
atcacgccggagcactcccaggtcatgctgtgcggcaacccggacatggtgaaggatacc
gccgcgatcctgcgcgagcgcgggctggagaagaaccgccgacgcaagccggggcagatc
acgaccgagaactactggtag

DBGET integrated database retrieval system