KEGG   Thioalkalivibrio versutus: TVD_01845Help
Entry
TVD_01845         CDS       T03959                                 

Definition
(GenBank) carbohydrate kinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00051  Fructose and mannose metabolism
tvr01100  Metabolic pathways
tvr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TVD_01845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvr04147]
    TVD_01845
Enzymes [BR:tvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     TVD_01845
Exosome [BR:tvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVD_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AKJ94189
UniProt: A0A0G3G1D8
Position
395053..395943
Genome map
AA seq 296 aa AA seqDB search
MARILATGIVTLDHTLDVAAFPAEDDEVRALASTTQPGGNATNTATILAQFGHRPGLAAV
IAEGAAGDALSASLEGHGLDVRHCVRRPGATPTSHILRSRETGSRTIVHHRDLPELGVED
LAGVPWPEYDWLHFEGRNPEALASILRAVRESIFDQPVSLELEKPRPGLDACLDYADVLM
LSRDWAASVAGTPEAALQQLSERFPDRILTVTAGGEGAWMAVRGAIHHCEATPGLRVVDS
VGAGDTFNAGLIHALVSGEPPEQALTAAVRLAERKLEQVGLDGLGNAASDPGAWPG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatcctcgcgactggcattgtcacgctcgaccacaccctcgatgttgcagcc
ttcccggccgaggacgacgaggtccgggcgctcgccagcaccacccagcccggaggcaac
gcgaccaacaccgcaacgatcctggcgcagttcggccaccgcccgggcctggccgcggtc
atcgccgagggtgcggccggggatgccctgagcgcgtccctggagggccacggactggat
gttcgtcactgcgtacgccggcccggagcgacgccgacctcccatattcttcgttccagg
gagacgggcagtcgcaccatcgttcatcaccgcgacctgcccgaactcggggtggaggat
ctcgcgggcgtaccctggccggaatatgactggctgcacttcgaggggcgtaacccggag
gcccttgcgtccatcctgcgcgcggtgcgcgagagcatctttgaccagccggtgtcgctg
gagctggagaagccccggccagggctcgacgcatgcctggactatgccgatgtcctgatg
ctctcgcgcgactgggccgcgagcgtggcgggcactcccgaggctgcgctgcagcagctt
tccgagcgctttcctgatcgcatcctgaccgtgaccgccgggggcgaaggggcctggatg
gccgtgcggggcgcgatccaccattgtgaagcgacgcccggactgcgggtggtcgacagc
gtgggggcaggggataccttcaatgccgggttgatccacgcgctggtctccggggagccc
ccggagcaggctttgacggccgctgtgcgcctggcggagcgcaagctcgagcaggtcggc
ctggacgggctgggtaacgcggcctccgacccgggagcgtggcccggatag

DBGET integrated database retrieval system