KEGG   Thioalkalivibrio versutus: TVD_13215Help
Entry
TVD_13215         CDS       T03959                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
tvr  Thioalkalivibrio versutus
Pathway
tvr00010  Glycolysis / Gluconeogenesis
tvr00030  Pentose phosphate pathway
tvr00051  Fructose and mannose metabolism
tvr00680  Methane metabolism
tvr00710  Carbon fixation in photosynthetic organisms
tvr01100  Metabolic pathways
tvr01110  Biosynthesis of secondary metabolites
tvr01120  Microbial metabolism in diverse environments
tvr01130  Biosynthesis of antibiotics
tvr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVD_13215
   00030 Pentose phosphate pathway
    TVD_13215
   00051 Fructose and mannose metabolism
    TVD_13215
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TVD_13215
   00680 Methane metabolism
    TVD_13215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvr04147]
    TVD_13215
Enzymes [BR:tvr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TVD_13215
Exosome [BR:tvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVD_13215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AKJ96259
UniProt: A0A0G3G7A2
Position
2842599..2843612
Genome map
AA seq 337 aa AA seqDB search
MHIGTTLTNYIIETQRGIQGATGEFTGLLNDISVACKKISDLVDKGDLVGVLGSAGSENV
QGETQKKLDIITNEVFIEALGHNGHAAGLASEEMDEICEMPAGAPRGHYLVLFDPLDGSS
NIDVNVSVGTIFSILKAPEGVSDPKTEDFLQPGTKQIAAGYCLYGPSTMMVLTTGKGVQM
FTLDKDFGEFLLTKDSVQIPEDTEEFAINMSNSRFWEAPVKRYIDECLAGKEGARDKDFN
MRWVASMVAEVHRILSRGGVFMYPMDSKMQAKGTAGKLRLMYEANPMSFIIEQAGGASTT
GRERIMDISPTGIHQRVPVVLGAKNEVERITRYHNEG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcggcacgactttgaccaactacattatcgagactcagcgcggtatccagggc
gcgaccggcgaattcaccggcctgctgaacgatatctcggtggcctgcaagaagatctcc
gacctcgtcgacaagggtgacctggtcggcgttctcggctccgccggctccgagaacgtg
cagggcgagacgcagaagaagctcgacatcatcaccaacgaggtgttcatcgaggccctg
ggccacaatggccacgccgccggcctcgcctccgaggagatggacgagatctgcgagatg
ccggccggcgccccgcgcggtcattacctggtcctgttcgacccgctggacggctcctcc
aacatcgacgtgaacgtctccgtcggcacgatcttctccatcctgaaggcgccggaaggc
gtctccgatccgaagaccgaggacttcctgcagccgggcaccaagcagatcgccgccggc
tactgcctgtacggtccgtccaccatgatggtgctgaccaccggcaagggcgtgcagatg
ttcaccctggacaaggacttcggcgagttcctgctgaccaaggacagcgtgcagatcccg
gaagacaccgaggaattcgcgatcaacatgtccaacagccgcttctgggaggcccccgtc
aagcgctacatcgacgaatgcctggccggcaaggaaggcgcccgcgacaaggacttcaac
atgcgctgggtggcctccatggtcgccgaggtgcaccgcatcctgtcgcgcggcggcgtg
ttcatgtacccgatggactccaagatgcaggccaagggcaccgccggcaagctgcgcctg
atgtacgaggccaacccgatgagcttcatcatcgagcaggccggcggtgcctccaccacc
ggtcgcgagcgcatcatggatatcagccccacgggcattcaccagcgcgtgccggtagtc
ctgggcgcgaagaacgaagtggagcggatcacccgctaccacaacgagggctaa

DBGET integrated database retrieval system