KEGG   Thioalkalivibrio versutus: TVD_13405Help
Entry
TVD_13405         CDS       T03959                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tvr  Thioalkalivibrio versutus
Brite
KEGG Orthology (KO) [BR:tvr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TVD_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKJ96294
UniProt: A0A0G3G7D4
Position
2887944..2889203
Genome map
AA seq 419 aa AA seqDB search
MEYSTLLLGLAVIFGLFMAWGIGANDVANAMGTSVGSRALTIRQAVFVAAIFVFSGAWLA
GGEVTQTIRSGMVDSSLMADNPELLVYGMLAALAAAGTWLMVASYFGWPVSTTHSIIGAI
VGFAVVGLGFEVVRWERVGTIAMSWVVSPLVGGMIAFALFRSVQILILDTVDPLKNAKRW
APLYIFLTAFVTALVTMFKGLTHVGLDLTPVQAYGFAILISAIVVVLGMMAIRRLRFDDP
TGVGEEGSHFANVEKVFGIQMVVTGCAMAFALGSNDVANAVGPLAAVVDVIQTGDVSTET
VVPMWVLLLGGVGIVFGLFTYGHKVIATVGTGITQLTPSRGYAATAAAAATVVLASGTGL
PISTTHTLVGAILGVGLARGIAAINLGLVRMIFLSWIVTLPAGAILAVVYFYILRGILG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaatacagcaccctgttgctcggccttgcagtgatcttcggcctgttcatggcctgg
ggcatcggcgccaacgacgttgccaatgccatgggcacctcggtgggctcacgcgcgctg
acgattcgccaggcggtgtttgtagccgcgatcttcgtgttctccggggcctggctggcc
ggcggcgaggtcacccagaccattcgcagcgggatggtcgactccagcctgatggccgac
aaccccgaattgctcgtttacgggatgctggcggccctggcagccgccgggacctggctg
atggtcgcctcctattttggctggccggtctccacgacccactccatcattggcgccatc
gtcggctttgccgtggtcggcctcggcttcgaggtggttcgctgggaacgtgtcggcacc
atcgcgatgtcctgggtggtctcgccgctcgtcggcgggatgatcgcctttgccctgttc
cgcagtgtgcagatcctgatcctcgataccgtcgatccgctgaagaacgccaagcgctgg
gcgccgctctatatcttcctcacggcctttgtcacggcactggtaacgatgttcaagggc
ctgacccacgtcggcctggacctcacgcccgtgcaggcctatggcttcgcgatcctgatc
agcgccatcgtggtcgtgctcgggatgatggcaatccggcgcctgcgctttgacgatccc
accggcgtgggcgaggaaggctcccatttcgccaatgtcgagaaggtgttcggcatccag
atggtggtgaccgggtgcgcgatggcctttgccctgggctccaacgacgtcgccaatgcc
gtcggcccgctggctgcagtcgtggacgtgatccagaccggcgatgtgagcaccgagacc
gtcgtgcccatgtgggtgctgctgctgggtggggtcgggatcgtgttcggcctgttcacc
tacggccacaaggtgatcgcgaccgtgggtaccgggatcacccagctcacccccagccgc
ggctatgccgccaccgccgcggcggcggccaccgtggtcctggcctccggcaccggcctg
ccgatctccactacccataccctagtgggcgcgatcctcggcgtgggcctggcacgcggg
attgccgcgatcaatctggggctggtgcggatgatcttcctatcctggatcgtgaccctg
ccggccggcgcgatcctcgcggtggtctacttctacatcctgcgcggcatcctcggataa

DBGET integrated database retrieval system