KEGG   Trametes versicolor: TRAVEDRAFT_112003
Entry
TRAVEDRAFT_112003 CDS       T04795                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
tvs  Trametes versicolor
Pathway
tvs00910  Nitrogen metabolism
tvs01100  Metabolic pathways
Module
tvs_M00531  Assimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    TRAVEDRAFT_112003
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     TRAVEDRAFT_112003
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Fer2_BFD Pyr_redox NIR_SIR_ferr Rieske Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 19407032
NCBI-ProteinID: XP_008033405
JGI: 112003
Position
Unknown
AA seq 1099 aa
MAETTTERKTIVVVGLGMVGIAFIEKLLDLDTAHNYRIVTCGEETHLAYNRVALTEYFQH
RNIEKLYLNPADWYAKQDPALFSFHVGESVASLDHASRSVTTDKGRTIVYDYCVLATGSD
AALPSYADLSIPGAFVYRNISDVNKLLEYAEKGEMKDCSAVVLGGGLLGLEAAKAVYDLP
SVKNVTIIHRQAFPLSRQLDAQGGEIVLRRIEAMGVTFLGSTSVKRVITNDNRAVSGLEL
VDGSTVDCSLVVFAIGISPRDDVARTAGLACAPRGGIVVDDHLQTSAPDVYAIGECASWK
NNTYGLIAPGIEMADILAFNFTQARTQIGTFQLRQMNTPDLSTKLKLMGVDVASFGDYLA
EQRIRATASRPAKEGPAQEAATSAATKPHDASAPKKRHGAAAAADGPVEALTYRDPFAGV
YKKYIFSADGRYLLGGMMVGDTSDYVKLVALVKKKKPLDAVPSQFILGSRAGQDDSGADL
DDDAQICSCHNVSKGRIVQCIKDGAESVADVKTMTKAGSGCGGCVPLLTNIVQAELKKAG
VAVSNNLCPHFAMSRADLFNVVKIKKLKTITAIMEAAGTHPNALGCEVCKPAVGSILSSL
WNEHIMDPAHHANQDTNDRFLGNIQRNGTFSVVPRVPAGEITPDKLVVLGQVAKKYGLYT
KITGGQRVDLFGAEKADLPSIWKELVDAGFESGHAYGKALRTVKSCVGTSWCRYGIGDSV
GLAVQLEERYKGIRSPHKFKGGVSGCVRECAEAQGKDFGLIATDKGWNIYVCGNGGANPR
HATILATDVPPSRVIRILDRFVMYYIRTADKLMRTARWLESMEGGIEKLRRVLLDDELGI
CADLERDMDELVGTYFDEWKAVVDDQERQRKFRQFVNTATGPQDERVPQTEMIVQRGQTR
PADWSKDTAPLILRETDIAFPKDKWRWRKVATIHDLTPTDSGTTSAAVRYGDSQIAIFHV
PGRGYFATQQMCPHRRAFVLDHGIIGDDPKTGSVYVSCPMHKRNYDLTSGACLNDDSYGI
IPFQVKVDGEDLSLLLPDEGDLDAVIGTSKWMVRQATAELLSKTAESTVEIVGPSDAILT
GEPQACGGGTSCGDAKLDW
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggcggagacaacgacggagcgcaagacgattgtcgtcgtcggcctaggaatggtcggg
atcgctttcatcgagaagctcctcgatttggacaccgcccacaactaccgcatcgtaacc
tgcggcgaggagacgcacttggcatataatcgagtcgctctcactgagtactttcaacac
cggaatatcgagaagctatacctcaaccccgcggactggtatgccaagcaggacccagca
ctgttttcgttccacgtaggggaatctgtcgcgtctctcgaccatgcctctcgctctgtg
accactgacaagggtcggacgatcgtgtacgactactgcgtactggcaactggttcggat
gccgcccttccgagttatgccgacctctccatccccggtgccttcgtttaccgtaacatc
tccgacgtcaacaagctgctcgagtacgcggagaagggagagatgaaggactgttcggcc
gtggtccttgggggcgggctcctcgggctcgaagccgccaaggcagtgtacgacctgccg
tcagtcaagaatgttacaatcatccacagacaggctttccctctctcgcggcagctcgat
gcgcaaggtggcgagatcgtcctccgccgcatcgaggccatgggtgtaacgttcttgggc
agtacgtctgtgaagagggtaatcaccaacgacaacagggcggtgtccggtctcgagcta
gtggatggctcaacggtagactgcagcctcgtcgtctttgcgattggcatcagtccgcgc
gacgacgtggcgcgcaccgctggtctcgcctgtgcaccgcggggcggcatcgtcgtcgac
gaccacctgcagaccagtgcgccggacgtctatgcgattggcgagtgcgcgagctggaag
aacaacacgtacgggctcatcgctcccgggatcgaaatggcggacatcctcgccttcaac
ttcacgcaggcgaggacgcagatcgggaccttccagctgcgtcagatgaacacaccagac
ttgtcgacaaagctgaagctcatgggggtcgacgtagcgtcgttcggcgactatctggca
gagcaacgtatacgggcgacggcatcgcgccctgccaaagaaggtcctgcacaagaggcg
gccacaagcgcagccactaaaccgcacgacgcgtccgcgcccaagaagcgtcacggagcc
gcagcggcagcagacggccctgtagaggcgctcacgtaccgcgatcccttcgcaggtgtc
tataagaaatacatcttcagcgccgatggcagatacctcctgggcgggatgatggtagga
gacacgtcggactacgtcaagctagtcgcgctggtgaagaagaagaaacccctggacgcg
gtgccgtcgcagttcatcctcggctcgcgcgccgggcaggacgactctggagcggacctc
gacgacgacgcgcagatctgcagctgccataacgtgtccaagggccgtatcgtgcaatgc
atcaaggatggcgccgagagcgtagccgatgtcaagaccatgactaaggctggatcgggc
tgtggaggatgcgtgccgctgttgacgaatatcgtgcaggcggagctcaagaaagcaggc
gtcgccgtgagcaataacctgtgtccccactttgcaatgtctagggcggatctattcaat
gtcgtcaagatcaagaagctgaagacaataactgccatcatggaggctgcgggcacacac
cccaacgcgttaggctgcgaggtctgcaagcccgcagtcgggagcattctgtcatcgctg
tggaacgagcacatcatggaccccgcgcaccacgcgaaccaggacacgaatgatcggttc
ctaggcaatattcagcgaaatgggacattctcggtcgtcccacgtgtaccggcaggagag
ataaccccggacaagctagtggtgctaggacaggtggcgaaaaaatatggtctctacacg
aagatcaccggcggacagcgggtagacctcttcggtgccgagaaggcagacctgccttcc
atctggaaagagctggtcgatgcgggcttcgagagcggccacgcgtacgggaaggcgctg
agaacagtcaagtcctgcgtgggcacgtcgtggtgtcgatacggcatcggcgactcagtc
ggattggccgtgcaattggaggagcgatacaagggcattcgctcgcctcacaagttcaag
ggcggcgtaagcggctgcgtacgggaatgcgctgaagcgcagggtaaggacttcggtctc
atcgctacagacaagggatggaacatttacgtctgcggtaatggcggtgcaaatccacga
cacgccaccatcctggcgaccgatgtgccgccatccagagtaatccgtattttggaccgc
tttgtcatgtattacattcgtacggctgacaagttgatgcgcaccgcgcgctggttggag
tcgatggagggaggcatcgagaaacttcgcagagtcttgttggacgacgagctgggcata
tgtgcggaccttgagcgagacatggacgagctcgttggaacgtacttcgacgagtggaag
gccgtggtggacgatcaagaacgacaacggaagttccgccagttcgtcaatacggcgact
ggcccgcaggatgagcgagtaccacagacggagatgatcgtccagaggggtcagacccgg
cctgcagactggagcaaggacaccgctccgctcatactgcgagagacggacatagcattt
cccaaggacaaatggaggtggcggaaggtggcaactatccacgatctcactcccacggat
agtgggacgacatctgcagccgtgcgatacggggacagccaaatcgccatctttcatgtg
cctggtcgcggctactttgcgacgcagcagatgtgcccccacaggcgagctttcgtgctc
gaccacgggattattggcgatgaccccaagacgggatccgtctacgtgtcgtgcccgatg
cacaaacgcaactacgacttgacctccggcgcttgcttgaacgacgactcgtacggcatt
atacccttccaagtcaaagtcgatggagaagacctttcccttctcctccccgacgagggc
gacttggacgcagtcatcggcacctcgaagtggatggttcggcaagccacagcagagctt
cttagcaagactgcggagtctaccgtcgagatcgtcggtccgtccgatgctatactcacc
ggggagccccaggcgtgtggcggcggcacgtcttgcggcgacgccaaactcgactggtga

DBGET integrated database retrieval system