KEGG   Trametes versicolor: TRAVEDRAFT_112163Help
Entry
TRAVEDRAFT_112163 CDS       T04795                                 

Definition
(RefSeq) cellobiohydrolaseI
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
tvs  Trametes versicolor
Pathway
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_112163
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     TRAVEDRAFT_112163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 19407044
NCBI-ProteinID: XP_008032771
JGI: 112163
Position
Unknown
AA seq 456 aa AA seqDB search
MFPSASLLAFSLLATVYGQQVGTLTAESHPRLTMQQCTSANNCQTQQHSVVLDSNWRWLH
STSGSTNCYTGNTWDASLCPDATTCAANCALDGADYAGTYGITTSGNALTLKFVTQGPYS
KNIGSRVYLMDANDQKYEMFNMKNQEFTFDVDMSNLPCGLNGALYFVEMDADGGAARFPT
NKAGSKYGTGYCDTQCPQDIKFINGQANIEGWEGSPTDPNAGSGNFGTCCNEMDVWEANK
NGAAFTPHVCSVQGQTRCSGEQCGDGDERYDGICDKDGCDFNSFRMGDQTFLGPGMTVDT
NQKFTVVTQFLTNNNQTSGTLSEIRRLYVQNGKVIANSKTNIPGLATFDSVTDEFCNAQK
EVFGDTNTFEQLGGLNQMGQSFDRGMALVMSIWDDHAAGMLWLDADYPTDVPATNPGVSR
GPCSATSGDPTTIENSEANSSVTFSNIKVGPIGSTY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttcccctcagcatccctcctcgcgttctcgctgcttgcgaccgtctacggtcagcag
gtcggcaccctcacggcagagagccacccccgcctcaccatgcagcaatgcacgagcgcg
aacaactgccagacccagcagcactccgtcgtgctcgactccaactggcgctggctccac
tcgacctccggcagcaccaactgctacaccggcaacacctgggacgcctcgctgtgcccc
gacgcgaccacttgcgccgccaactgcgctctcgacggtgctgactacgccggcacctac
ggtatcaccaccagcggcaacgcgctcacgctcaagttcgtcacccagggcccgtactcg
aagaacatcggttcgcgtgtctacctcatggacgccaacgaccagaagtacgagatgttc
aacatgaagaaccaggagttcaccttcgacgtcgacatgtcgaacctcccctgtggtctc
aacggcgcactctacttcgtcgagatggacgcggacggtggcgcagcgcgcttccccacc
aacaaggccggcagcaagtacggaactggctactgcgacacccagtgcccgcaggacatc
aagttcatcaacggccaggccaacatcgagggctgggagggctcccccaccgaccccaac
gcgggctcgggcaacttcggtacctgctgtaacgagatggacgtctgggaggcgaacaag
aacggcgcggccttcaccccccacgtctgctccgtccaaggccagacgcgctgctcgggc
gagcagtgcggcgacggcgacgagcggtacgacggcatctgcgacaaggacggctgcgac
ttcaactcgttccgcatgggcgaccagaccttcctcggcccggggatgacggtcgacacg
aaccagaagttcacggtcgtcacgcagttcctgacgaacaacaaccagacgtccggcacg
ctctccgagatccgccgcctgtacgtgcagaacgggaaggtgatcgcgaactcgaagacg
aacatccccgggctcgcgacgtttgactccgtcacggacgagttctgtaacgcgcagaag
gaggtcttcggcgacaccaacacgttcgagcagctcggcggcctcaaccagatgggccag
tccttcgaccgcggcatggcgctcgtcatgtccatctgggacgaccacgctgcgggcatg
ctctggctcgacgccgactaccccaccgacgtccccgccacgaaccccggtgtctcccgc
ggcccctgctcggccacctccggcgacccgaccacgatcgagaacagcgaggcgaactcg
tccgtcaccttctcgaacatcaaggtcggccccatcggctcgacttactga

DBGET integrated database retrieval system