KEGG   Trametes versicolor: TRAVEDRAFT_124939Help
Entry
TRAVEDRAFT_124939 CDS       T04795                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
tvs  Trametes versicolor
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TRAVEDRAFT_124939
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     TRAVEDRAFT_124939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin FERM_F1
Motif
Other DBs
NCBI-GeneID: 19407988
NCBI-ProteinID: XP_008039711
JGI: 124939
Position
Unknown
AA seq 162 aa AA seqDB search
MSDAKSFYELSASLPGGKTYKFEELKGKVVLIVNVASKCGFTPQYKGLQALYDKHKEKGF
VILGFPCNQFGGQEPENDEKIAQFCELNHGVSFPLMAKSDVNGDATNEVYKWLKGQKAGI
LGLTRIKWNFEKFLIDREGKVVHRWASTTSPEAIDTEVEKLL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaaagtccttctacgagctctccgcgtccctcccgggcgggaagacgtac
aagttcgaggagctcaagggcaaggtcgtcctcatcgtcaacgttgcatccaagtgcggg
ttcacgccgcagtacaagggcctgcaggcgctgtacgacaagcacaaggagaagggcttc
gtcatcctcggcttcccgtgcaaccagttcggcgggcaggagcccgagaacgacgagaag
atcgcgcagttctgcgagctcaaccacggcgtctccttccccctcatggccaagtccgac
gtcaacggcgacgccacgaacgaggtctacaagtggctcaagggccagaaggccggcatc
ctcggcctcacccgcatcaagtggaactttgagaagttcctgatcgaccgcgagggcaag
gtcgtccaccgctgggcgtcgacgacgtcccccgaggcgatcgacaccgaggtcgagaag
ctcctctga

DBGET integrated database retrieval system