KEGG   Trametes versicolor: TRAVEDRAFT_147688
Entry
TRAVEDRAFT_147688 CDS       T04795                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tvs  Trametes versicolor
Pathway
tvs00100  Steroid biosynthesis
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
Module
tvs_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TRAVEDRAFT_147688
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TRAVEDRAFT_147688
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 19409590
NCBI-ProteinID: XP_008037887
JGI: 147688
Position
Unknown
AA seq 435 aa
MSPSAVSKTSSEVNPRTTHYEFLGPPGAFAISFGVPFMTYALYFGCSEHTGGCPPPVDTA
LILDSLSSLEWWKGLWDTQATLFYLGWYAFIVASWAVLPGDWVEGVTLRTGGKKKYKINA
FSTFLLTAGITAGIIYRYGPQPLTFIYEKWVGLTTAAILMSIVQGLGCYLASFREGAILA
LGGNSGNPIYDFYIGRELNPSIGSFDLKTFNELRPGLILWVLIDVGLACEQAVRRGGSIT
DSMWLVLAFQGWYVVDALYNEPAIFTTMDITTDGFGFMLAVGDLAWVPFVYSLQARYLVF
NQVELGPVNTALVIAVNLAGYYIFRSSNGEKNDFRNGRNPKNLQYMQTERGTKLLTSGWW
GRSRHPNYMGDLLMAFAWSLPTGFNTPITYFYVIYFAVLLIHRERRDDEACEKKYGKDWK
KYKTLVPWRIVPYVY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccccctccgccgtctccaagacgtcgtccgaggtgaatccccggacgacgcactat
gagttcctgggtcctcctggcgcatttgccatcagctttggcgtgccgttcatgacatat
gccctctacttcggctgctccgagcacaccggtggctgcccgccccctgtcgacactgcg
ctcattctcgactcgctctccagtctcgagtggtggaagggtctctgggacacccaggcg
acgctcttctaccttggctggtatgcgttcatcgtcgcgtcgtgggcagtgctccccggt
gactgggttgagggagttactctgcgcaccggcgggaaaaagaagtacaagatcaacgca
ttctccaccttccttctgactgcgggcatcaccgcgggcatcatctatcgctacggtcct
cagccactgaccttcatctatgagaagtgggttggtctcaccaccgccgccatcctcatg
tcgatcgtacaaggtcttggctgctatctggcgtcgttccgtgagggagctatcctcgcg
ctcggtggtaacagcggcaaccccatctacgatttctatattggtcgcgagttgaacccg
tccattggctcgtttgacctgaaaaccttcaatgagctccgcccgggactcatcttgtgg
gtgctgattgacgtcggtttggcgtgcgagcaagcggtgcgccgcggaggaagcatcacg
gactcgatgtggctcgtccttgctttccaggggtggtacgttgttgacgctctctacaac
gagcccgccatcttcaccacgatggacatcaccacggacgggttcggcttcatgcttgca
gttggagaccttgcctgggttcccttcgtctactctctccaagctcgttacctcgtcttc
aaccaggtcgagctcggccctgtgaacacggctcttgtgattgctgttaacctggctggc
tactatatcttccgctcatcgaacggcgagaagaacgacttccggaatggacgcaacccc
aagaacctccagtacatgcagaccgagcgcggcaccaagctcctcacctccggctggtgg
ggcaggtcccgtcacccgaactacatgggcgacttgttgatggccttcgcgtggtctctc
ccgacagggttcaacaccccaatcacctacttctacgtcatctacttcgcggtgcttctc
attcaccgtgaaagacgagatgacgaggcgtgcgagaagaagtatggcaaggactggaag
aagtacaagaccctcgtgccttggcgcattgtcccgtacgtgtactaa

DBGET integrated database retrieval system