KEGG   Trametes versicolor: TRAVEDRAFT_152999Help
Entry
TRAVEDRAFT_152999 CDS       T04795                                 

Definition
(RefSeq) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tvs  Trametes versicolor
Pathway
tvs00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRAVEDRAFT_152999
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tvs01007]
    TRAVEDRAFT_152999
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tvs03016]
    TRAVEDRAFT_152999
   03029 Mitochondrial biogenesis [BR:tvs03029]
    TRAVEDRAFT_152999
Enzymes [BR:tvs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     TRAVEDRAFT_152999
Amino acid related enzymes [BR:tvs01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TRAVEDRAFT_152999
Transfer RNA biogenesis [BR:tvs03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TRAVEDRAFT_152999
 Prokaryotic Type
   Other AARSs
    TRAVEDRAFT_152999
Mitochondrial biogenesis [BR:tvs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TRAVEDRAFT_152999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 DUF4880
Motif
Other DBs
NCBI-GeneID: 19409877
NCBI-ProteinID: XP_008042149
JGI: 152999
Position
Unknown
AA seq 616 aa AA seqDB search
MASTSAESSTANKPTLAPSPFAVPTDLPALPEVAGTDPTRCVLDSFRIAIAKVVADALEP
LTVEQVYQGVDYGKKGEDFTVALPRFKLPGKIDELAKKVIGKFQPDEWVESVTHDRAFLH
FRCRTSTLMRLTLDQIHALTYDTASKQPEYGSNFLGEGKRVIIEYSSPNIAKSFHVGHLR
STIIGAFLANLYKACGWEVISMNYLGDWGTQFGLIAVGFEKYGSQEALEKDAIQHLFEVY
VKISAAAEADPTIRDEAAAWFRRMEDGDEEALKNWRVWRKLSVGKYAEEYARLNVHFDVY
TGESEVPQAAMDAALGRLRELALIEEDNGALRVNLEKHKLGKAVVRKRDGTSIYLTRDIG
GAVNRYDQYKFDKMIYVISAQQDMHVAQFFKVLELMGYEWAKSLEHVNYGLVLGMSTRRG
TVVFLDQIIREASTVMHDQMRKNEEKYNAVENPEFVATEIGITGVKIQDMAAKRINNYSF
NWERMLSFEGDTGPYLQYAHVRLSSIERKNPELLPLPAPSQLHTDLLVESQTREIVFLLG
SYPDVVKTALKTHEPSGIVTFAFRLSHGISSAWETVIVKGEQDKEKAKARMALYLAARDV
LGAALRLLSIKPLERM
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacatccgcggaatcatccaccgccaacaagcccacgttggcgccctcgccg
ttcgcggtgcccaccgatctgcccgccctcccagaggtcgcgggcacggaccccacgcga
tgcgtgctcgactcgttccggatcgcgatcgcgaaggtcgtcgcggatgcactggagccg
ctgaccgtcgagcaggtctaccagggcgtggactacgggaagaagggggaggatttcacc
gtcgcgctgccgcggttcaagctcccgggcaagattgatgagctcgcgaagaaagtgatc
ggaaagttccaaccagacgaatgggtcgagtccgtcacgcacgaccgcgccttcctccac
ttccgctgccgaacgtcgacgctcatgcgcctcacgctcgaccaaatccacgcgctcacc
tacgacaccgcctcaaaacagcccgagtacggctcgaacttcctcggggagggcaagcgc
gtgatcatcgagtactcgtcgccgaacatcgcgaaatccttccacgtcggccatttgcgg
agcacgatcatcggcgcgttcctcgcgaacttgtataaggcgtgcggctgggaggtcatc
tccatgaactacctcggcgactggggcacccagttcggcctcatcgccgtcgggttcgaa
aagtacgggtcgcaagaagcgctcgaaaaggacgcgatccagcacctgttcgaagtctac
gtgaagatcagcgccgcggcggaggcggacccgacgatccgcgacgaggccgcggcgtgg
ttccggcggatggaggacggggacgaggaggcgctgaagaactggcgcgtgtggcgcaag
ctctccgtgggcaagtacgcggaggagtacgcgcgcctgaacgtgcactttgacgtgtac
acgggcgagagcgaggtcccgcaggcggcgatggacgcggcgctgggccgcctgcgcgag
cttgcgctcatcgaggaggataatggcgcgctgcgtgtgaacctcgagaagcacaagctc
gggaaggccgtcgtccggaagcgggacggaacgtcgatctacctgacgcgcgacatcggc
ggcgcggtgaaccgctacgaccagtacaagttcgacaagatgatctacgtgatctccgcg
cagcaggacatgcacgtcgcgcagttcttcaaggtgctcgagctgatggggtacgagtgg
gcgaagagcctcgagcacgtgaactacgggctcgtgctgggcatgagcacgcgccgcggc
acggtcgtgttcctcgaccagatcatccgcgaggcgtcgacggtgatgcacgaccagatg
cggaagaacgaggagaagtacaacgcggtcgagaaccccgagttcgtcgcgaccgagatc
gggattactggcgtcaagatccaggacatggctgccaagcggatcaacaactacagcttc
aactgggagcgcatgctctcgttcgagggcgacaccgggccgtatttgcagtacgcgcac
gtccgcctctcgtcgatcgagcgcaagaacccggagctgctgccgctccccgcgccctcg
cagctgcacacggacctgctcgtcgagtcgcagacgcgcgagatcgtgttcctgctgggc
tcgtacccggacgtggtgaagacggcgctgaagacgcacgagccgagcgggatcgtgacg
ttcgcgttccggctgtcgcacgggatctcgagcgcgtgggagacggtgatcgtgaagggc
gagcaggacaaggagaaggcgaaggcgcggatggcgctgtacctcgcggcgcgcgacgtg
cttggggcggcgctccggctgctcagcatcaagcccctcgagcgcatgtag

DBGET integrated database retrieval system