KEGG   Trametes versicolor: TRAVEDRAFT_30697Help
Entry
TRAVEDRAFT_30697  CDS       T04795                                 

Definition
(RefSeq) FabD/lysophospholipase-like protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tvs  Trametes versicolor
Pathway
tvs00564  Glycerophospholipid metabolism
tvs00565  Ether lipid metabolism
tvs00590  Arachidonic acid metabolism
tvs00591  Linoleic acid metabolism
tvs00592  alpha-Linolenic acid metabolism
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRAVEDRAFT_30697
   00565 Ether lipid metabolism
    TRAVEDRAFT_30697
   00590 Arachidonic acid metabolism
    TRAVEDRAFT_30697
   00591 Linoleic acid metabolism
    TRAVEDRAFT_30697
   00592 alpha-Linolenic acid metabolism
    TRAVEDRAFT_30697
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     TRAVEDRAFT_30697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B CM_1
Motif
Other DBs
NCBI-GeneID: 19413396
NCBI-ProteinID: XP_008041002
JGI: 30697
Position
Unknown
AA seq 673 aa AA seqDB search
MPPDIPWPTSFSVSDLQQRLSALILELGLGPGSLYDQIVNAPVDPAVHPECDWDAEVRLG
EDLCLAERVFLSERKRRMKASFAELMGVPDSEVDERDLPIVAIAGSGGGYRAMLNTLGSL
SAAKSLGVLDCVSYTAGVSGSCWALGILYSGVAGSNQPEDAAAHAKDRIQLSYLDMDTLD
ALVTPPTNKYLLAGILRKAAGPTGTASLVDLYGTLLSSRLYIPTDVTKLDPRHLSLHLYR
RNLDNGALPLPIFSAIQHVTQLEKAEDIKEVADEKALSIRNQRSWSLDSEQARLEQDIRW
LWYEFTPYEVGCDEIGAWIPSWALGRRFMNGKNTERRPELSFTILAGVFGSAFCASLKHY
FREIEPVLQLFPAQLYNWLEEIVTENEGDLGLIHPVLPDQLPNFVRGLEGQLRYGSPPDI
TEHETLGFMNAAAELNLPYYPLLRRNVDCVIALDASADSQDLWFTRAEELAAKRGLHTWP
RGATWPTRVHPGDEGAAETSRVPDYEASSPDSANAKLAQTQESALAKQTDKQGSTDKREM
PNDEPRPPSKSTLNTCEVWIGSSKSTDEASARLDELDEAALLKRDGIAVVYIPLMPNDSR
VPGFDPFSVSTWRREVAAEESQNLLDVAEANFSDSREKIVRLLRAVWMRKKMERQQHEWR
ARLDHLREQFKHQ
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccccctgacatcccgtggccgacatcattctcggtatccgacctacagcagcgtctc
tccgcactcatactagaactcggcctcggacctgggtctctatacgatcagatcgtaaat
gcacccgtcgacccggccgttcaccccgagtgcgactgggacgcagaggttcgcctcggt
gaggacctgtgtctagccgaacgcgtgttcttgagcgagcggaaacgacgcatgaaagcc
tcattcgccgagctcatgggtgttcctgacagcgaggttgatgagcgggacctgcctata
gttgctatcgccggttcgggaggaggctatcgggcgatgctcaacaccctgggatcgctt
tcggcggcgaaaagccttggtgtgctagactgcgtatcatacaccgctggcgtgtctggg
agttgctgggcattgggaatactgtactcgggcgtggcgggttccaaccagcccgaggac
gctgctgcgcacgccaaggatcgcatacagctcagctacctggatatggacacgctagat
gcgctagtgacccctcccacgaacaagtacctccttgctggcatcctccgcaaagcagcg
ggtcccacgggcacagcgtcacttgtggacctctatggcacgctgctttcttcgcggctg
tacatccccacggacgtcacgaagctcgacccacgacacctctctctgcacctctatcgc
aggaacctagacaacggcgccctgccgctccctattttcagcgctatccaacacgtcacc
caactggagaaggcggaggacatcaaggaagtcgccgacgagaaggcgctgtcgatccgc
aatcagcgctcgtggtcattagacagcgaacaggcgcggctcgagcaggacattcggtgg
ctgtggtatgaattcacaccgtacgaggttgggtgcgatgagattggcgcctggattcct
tcctgggcccttggcaggcgcttcatgaacggcaagaacactgagcgcagacccgagctg
agctttacgatacttgctggcgtcttcggatctgccttctgcgcatcgctcaagcactac
ttccgcgagatcgagcccgtgcttcagctcttcccggcacagttgtacaactggctcgag
gagatcgtcactgagaacgagggggacctgggtctcattcatcccgtgctgccagaccag
cttccgaacttcgtgaggggtcttgaagggcagctgcgctacggcagcccgcccgacatc
accgaacatgaaacactaggcttcatgaatgctgcagcggagctgaatcttccttactat
ccccttctccgaagaaacgtagactgtgtcatcgctctggacgcaagcgcagactcccag
gatctgtggttcactcgagcggaagaactcgccgcgaaacgcggtctccacacctggccg
cgcggcgcaacatggcctacccgcgtgcacccaggcgacgagggcgcagcggagacgtcg
cgtgtccctgactacgaggcgtcctccccagactccgccaacgccaagctcgcccaaacg
caggagtccgcgctcgccaagcagacagacaagcagggctccactgacaaacgcgagatg
ccaaatgacgagccaaggcctccctcgaagtccacgctgaacacgtgcgaggtgtggatc
gggtcgtcgaagtccacagacgaggcgtccgcgcgcctggacgagctcgacgaagccgcg
cttctgaagcgcgacggcatcgccgtcgtctacatcccgctcatgccaaacgacagtcgt
gtccccggcttcgacccgttctctgtctcgacgtggcgccgcgaggtcgccgcggaggag
agccagaacctcctcgacgtcgcagaggcgaacttctcggactcgcgcgagaagatcgtg
cgcctgttgcgcgcggtgtggatgcggaagaagatggagcggcagcagcacgagtggcgg
gcgcgtttagaccatctgcgcgaacagttcaagcaccagtga

DBGET integrated database retrieval system