KEGG   Trametes versicolor: TRAVEDRAFT_47996Help
Entry
TRAVEDRAFT_47996  CDS       T04795                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
tvs  Trametes versicolor
Pathway
tvs00052  Galactose metabolism
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TRAVEDRAFT_47996
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_47996
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     TRAVEDRAFT_47996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19415677
NCBI-ProteinID: XP_008038414
JGI: 47996
Position
Unknown
AA seq 538 aa AA seqDB search
MRFCTAVVLAATLLSSVIAQDPTVPAIPTGTPIPGIYNGTYRPQVHFSPPQHYMNDPNGL
FLDANGTYHLYYQYNPTANTAGDQHWGHATSRDLYHWINQPIAIFPPTNDTQVFTGSAVV
DVNNTSGFFPDQDNGVVAIYTLNTPTGQVQDISYSVDGGYTFTAFSGNPVLTSTSTQFRD
PKVMIVSFAADLTLGFYTSPDLKTWSSASNFTYPNSVNQFECPNIVKMPVQGSNDSMYVL
STSISSGGPAGGGAIIYFPGTFNGSHFTAVDDTPRFIDFGADSYAGQFFSGIPDGDDALF
IAWATNGQYSQDTPTAQEGWRSTMSLPRRNRLAPNATSGGYDLITVPQDLSPVLGEQLAS
MADLANGTFFVDYSAVASNVIYFEANVTGVSGASDTSTLNFTIQSPISGESVRGRYSFGG
NNTFVVDRSGVHGFNNTAFTGTPFTTTSAVRADGTWTLAGVVDRSILEVFVGSGVASATA
LFFATQPLTVFTLSTAQLPANASVSVAVYAVRSAWKVEENGEGVVVGNVTTIASRDEL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgagattctgcacggcagtcgtattagcggcgacacttctcagcagcgtcattgctcag
gacccaacggtccctgccatcccaacgggcacaccgatccctgggatctataatggcaca
tacaggccgcaggtccacttctcgccccctcagcattatatgaacgacccgaatgggctg
ttcttggatgccaacggaacctaccatctgtactaccagtataaccctacagcgaacacc
gcgggggaccagcactggggacatgctacgagccgggatctctaccactggatcaaccag
cccattgcgatctttccaccgaccaatgacacgcaagtctttactgggtctgccgtcgtc
gacgtcaacaacacatcaggcttcttccccgatcaggacaacggcgtcgttgcgatctat
actctgaacacgcccacaggacaagttcaagatatctcgtactccgtcgacggagggtac
accttcaccgctttctctgggaaccccgtcctcaccagcacgtcgacgcaattccgcgac
ccgaaggtgatgatagtctcgttcgctgcggacctaacgctcggcttctacacgtctccg
gacctcaagacgtggtcgagcgcgtccaacttcacttatcccaactccgtcaaccaattc
gaatgccccaacatcgtgaagatgccagtgcagggcagcaatgacagcatgtacgtgctg
tccaccagcatcagctccggcgggcccgccggaggcggagccatcatatacttccccggc
acgttcaacggctcgcacttcaccgcggtcgacgacaccccgcgcttcatcgacttcggg
gcagatagctacgcgggccagttcttctctgggatcccggacggcgacgatgcgctgttc
atcgcgtgggctaccaacgggcagtactcgcaggacacgccgaccgcccaggagggctgg
cgcagtacgatgtcgctcccgcgccgcaaccgcctcgcgccaaacgccacgagcggtggc
tacgacctgatcacggtcccccaagacctttcccccgtgctcggcgagcagctagcctcg
atggccgacctcgcgaacggcacgttcttcgtcgactacagcgcggtcgcctccaacgtg
atctacttcgaggccaacgtcactggcgtctcaggcgcaagcgacacctcgacgcttaac
ttcacgattcagagccccatctcgggcgagtcggtgcgcggccggtactcgttcgggggc
aacaacacgttcgtcgtcgaccgcagcggcgtgcacgggttcaacaacacggccttcacg
ggcacgccgttcacgacgacgagcgcggtgcgcgcggacgggacgtggacgctggcgggc
gtggtcgaccggagcatcctcgaggtgttcgtgggcagcggtgtggcgagcgcgacggct
ctgttcttcgcaacgcagccgctgacggtgttcacactttctacggcgcagctcccggcg
aacgcatcagtaagtgtggcggtatatgcggtccgcagcgcgtggaaggtggaggagaac
ggggagggggttgtggtgggcaatgtcacgactatcgcgtcccgagacgagttgtaa

DBGET integrated database retrieval system