KEGG   Trametes versicolor: TRAVEDRAFT_52360Help
Entry
TRAVEDRAFT_52360  CDS       T04795                                 

Definition
(RefSeq) NAD-P-binding protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tvs  Trametes versicolor
Pathway
tvs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TRAVEDRAFT_52360
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TRAVEDRAFT_52360
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TRAVEDRAFT_52360
    1.1.1.-  
     TRAVEDRAFT_52360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP FTR 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 19416813
NCBI-ProteinID: XP_008043452
JGI: 52360
Position
Unknown
AA seq 319 aa AA seqDB search
MFQHNILDGPPTATEPHPTSGETLPVGVGHEFSGTIAELGPNVDTSKYAVGKNVAVEPII
GCNTPGCACASTHTRNLCPRFAAIGISGGGGGLSEYVVVPQTLAHVLPANVSLEIGALVE
PLAVAWRAVKLSHVKARDKVLILGAGPIGVFVLKVAQIFGASWVGISGRGSKRCALAHKY
GASVVYDAAAGIDVVAETLKATDGRGADVVVDCAGSQSTLDTALKASRPGGTIMNVAGWT
ARPTIDMNLMLMKELVLANSIGYAGDHPELIQALADGKFDLDDLEALITRRVGLEDYLEK
GLGALLHEKDQHVKVLIHP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttccaacacaacatattggatggcccacccaccgccactgaacctcatcctacatcg
ggggagacgctgccagtaggcgtcggtcacgagttctctggaaccatcgctgaattgggt
ccgaacgtcgatacatccaagtacgccgttggcaagaatgtggctgttgagccgatcatt
gggtgcaacacgcctggttgcgcatgcgcttcaacccacacccgaaacctgtgccctcgg
ttcgcagccatcggtatttctggtggtggcggtggtctctccgagtacgtcgtagtgccg
caaacactcgcccacgtactgccggcgaacgtctctctggagatcggcgccctcgtggaa
ccgctcgcggtcgcttggcgtgcagtcaagctatcgcacgtcaaagcgagggacaaggtc
ctcatcctcggcgctggcccgatcggcgtctttgtgctcaaagttgcccagatatttggg
gcgtcctgggtaggcatctcggggcgcggctccaagcgctgcgctctggcccacaagtat
ggcgcatccgtggtttacgacgccgccgctggaatagacgtcgttgcggagacgctgaag
gcgacggacggccggggcgcagacgtcgttgtggactgcgccgggtcccagagcactctc
gacactgcgttgaaggcatcccgccccggtgggacgatcatgaacgtcgcgggatggacg
gcgcggcccacgatcgacatgaacttgatgttgatgaaggagctcgttctcgctaatagc
ataggctacgctggagaccatcctgagctgatccaagcccttgccgatggcaagtttgac
ctggacgatctggaggccttgattactcgtcgcgtggggttggaagactacctggagaag
ggactcggcgccctcctccatgagaaggatcaacatgtcaaggttttgattcacccttga

DBGET integrated database retrieval system