KEGG   Trametes versicolor: TRAVEDRAFT_63713Help
Entry
TRAVEDRAFT_63713  CDS       T04795                                 

Definition
(RefSeq) RNA-binding domain-containing protein
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
tvs  Trametes versicolor
Pathway
tvs03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TRAVEDRAFT_63713
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tvs03041]
    TRAVEDRAFT_63713
   03110 Chaperones and folding catalysts [BR:tvs03110]
    TRAVEDRAFT_63713
Enzymes [BR:tvs01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     TRAVEDRAFT_63713
Spliceosome [BR:tvs03041]
 Complex B
  Other components
   Prp19-related factors
    TRAVEDRAFT_63713
 Complex C
    TRAVEDRAFT_63713
Chaperones and folding catalysts [BR:tvs03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    TRAVEDRAFT_63713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM
Motif
Other DBs
NCBI-GeneID: 19418513
NCBI-ProteinID: XP_008036506
JGI: 63713
Position
Unknown
AA seq 157 aa AA seqDB search
MEEGTKSKKTVFVGGIGDDVDETVILENFSPFGDVIEVQLPTAPSNPSHPNDSKHRGFAF
VTYSSPADAQDAIDNMDLNELNGRVLRVNLARPMKGPLQPQGNRAIWESEEWLQKNVKPL
GESGGHALRAQTAAGGGAPGEEGEAEEGHEDENAMEE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacaaaatccaagaaaaccgtcttcgtcgggggcatcggcgacgacgta
gacgagaccgtcatcctcgagaacttctcccccttcggtgacgttattgaagtacaactt
ccgaccgcaccgtccaatccctcgcaccctaacgattcaaaacatcgtgggttcgccttc
gtgacgtactcctcgccggccgatgcccaggatgccatcgacaacatggacctcaacgaa
ctcaatggtcgggtgctcagggtcaacctcgcccggcctatgaagggccctcttcaaccc
caaggcaacagagctatttgggaatccgaagaatggctccagaagaacgtcaaacccctc
ggtgaaagtggaggtcacgcgttgcgcgcccagacggccgctggaggtggcgcaccaggt
gaggagggcgaagccgaagaagggcatgaagacgagaatgccatggaggagtaa

DBGET integrated database retrieval system