KEGG   Thermoactinomyces vulgaris: AB849_009600Help
Entry
AB849_009600      CDS       T05864                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
tvu  Thermoactinomyces vulgaris
Brite
KEGG Orthology (KO) [BR:tvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tvu03009]
    AB849_009600
Enzymes [BR:tvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AB849_009600
Ribosome biogenesis [BR:tvu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AB849_009600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TGS
Motif
Other DBs
NCBI-ProteinID: QBK14593
Position
1852268..1853191
Genome map
AA seq 307 aa AA seqDB search
MEHYEWTIDDSADGERLDKFLPQKNEEWSRARVQEWIRAQLAWVNGKNKKGNYRLKQGDV
VTLNVPPVTEAEIRPEPIPLDIRYEDEDVIVVNKPRGMVVHPGPGNNSGTLVHALLAHCG
DELSGIGGVARPGIVHRIDKDTSGLLMVAKNDLAHQSLAAQLKEHSVERVYVAFCHGVIP
HDHGTVDAPIGRDPKHRQRMAVISQNSKPAVTHFFVRERFQQATWVECRLETGRTHQIRV
HMKYIGHPLIGDPVYGPKKNPYAIEGQALHAQVLGFTHPRTGRRIRLEAEWPEDMRKIYK
ALKQPFC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggagcattatgaatggacaatcgatgattctgcagacggggagcggttagacaaattc
cttccccaaaaaaatgaagaatggtcgcgtgcacgggttcaagaatggatccgtgcccaa
ttggcttgggtgaacggaaaaaataaaaaaggaaattaccgtttgaagcaaggggatgtg
gtcaccctcaatgtcccgccggtcacagaggccgaaatccgcccggaaccgattcccttg
gacatccgttatgaagatgaggatgtcattgtggtgaataaaccccgggggatggtggtg
catccgggaccgggaaacaattcgggaacgttggttcatgcgcttttggcccattgcggg
gatgaactgtcggggattggaggggttgcccgccccggaatcgttcatcgcattgacaag
gacacctccgggttgttgatggtggctaaaaatgatctggcacaccagtcgttggcggca
caattgaaggagcattcggttgagcgggtgtatgttgctttttgccatggcgtgattccg
cacgatcacggcacagtggatgcccccatcggaagggatcccaaacaccgtcagcgaatg
gctgtgatctctcaaaacagcaaaccggcggtgacgcatttttttgtgcgggaacgattt
caacaggcgacatgggtggagtgccggctggaaacgggccggacgcaccagattcgggta
catatgaaatatatcgggcatccgctcattggggatccggtctacggtccgaagaaaaat
ccctatgcgattgaggggcaagccctgcatgcacaagtgctcggctttacgcacccgaga
acgggccggcgtatccgtttggaagcggagtggccggaggatatgagaaaaatttacaag
gcattaaagcagccgttttgttga

DBGET integrated database retrieval system