KEGG   Thermoanaerobacter wiegelii: Thewi_0099Help
Entry
Thewi_0099        CDS       T01607                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00010  Glycolysis / Gluconeogenesis
twi00052  Galactose metabolism
twi00500  Starch and sucrose metabolism
twi00520  Amino sugar and nucleotide sugar metabolism
twi00521  Streptomycin biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
Module
twi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
twi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_0099
   00052 Galactose metabolism
    Thewi_0099
   00500 Starch and sucrose metabolism
    Thewi_0099
   00520 Amino sugar and nucleotide sugar metabolism
    Thewi_0099
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thewi_0099
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thewi_0099
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thewi_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEM77609
UniProt: G2MVU6
Position
109328..110275
Genome map
AA seq 315 aa AA seqDB search
MVKILCGVDLGGTKISTGLVDEKGNIIKSIKIPTMAEKGPEEVIKRIEQSVYDVLKEAGL
KISDLKGVGIGSPGPLDAKRGVVISPPNLPGWDNVPIVDILSHKLGVEVKLENDANAAAI
GEHLFGAGRGIDNFVYITVSTGIGGGVIIQGKLYSGENSNAAEIGHHTINFNGPLCNCGN
YGCFEAFASGTAIARFAQEGIQNGKDTMIRDLAKDGVVKSEHVFEAAKLGDEFAEELVDN
EAFYLGVGISNIMAFYNPKRIAIGGGVSTQWEMLYDKMMETIKKKALKPNAEVCEVVKAE
LGENVGVLGAAALLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatcctatgcggtgtggacttaggggggacaaagataagtacagggcttgta
gatgagaagggcaatatcataaagagcatcaaaatacctactatggcagaaaaagggcca
gaagaagtaattaagcgaatcgaacaaagtgtttatgacgttttaaaagaagcaggatta
aaaatatctgatttaaaaggagttgggattggatctccagggccccttgatgccaaaagg
ggggtagttataagcccacctaatcttccaggttgggacaatgttcccattgtggatatt
ttatctcataagctgggagttgaagtaaaattagagaatgatgcaaatgctgcagctatt
ggagaacatttatttggcgcaggaagaggtatagacaattttgtttatataactgtaagt
actgggattggtggtggcgtgataattcaaggaaaactttatagcggagaaaattctaat
gcagctgagattgggcaccatactataaattttaatgggcctctatgtaattgcggaaat
tatgggtgctttgaggcttttgcttctggtacggctattgcgagatttgctcaagaagga
attcaaaatgggaaagatacaatgataagggatttagccaaagatggagtagtaaaatcg
gaacatgtatttgaagcggcaaaattgggagatgagtttgcggaagaattggttgacaat
gaagctttttatcttggagtgggaatttcaaatatcatggctttttataatccaaaaaga
attgccataggtggtggcgtatccactcaatgggagatgctttatgataaaatgatggaa
acaataaagaaaaaagctttaaagcctaatgccgaagtatgtgaagtagtaaaagcagag
cttggagaaaacgtgggtgttttaggagcggcagcattacttttataa

DBGET integrated database retrieval system