KEGG   Thermoanaerobacter wiegelii: Thewi_0370Help
Entry
Thewi_0370        CDS       T01607                                 

Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00261  Monobactam biosynthesis
twi00300  Lysine biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01230  Biosynthesis of amino acids
Module
twi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Thewi_0370
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Thewi_0370
Enzymes [BR:twi01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Thewi_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AEM77859
UniProt: G2MUV8
Position
396942..397817
Genome map
AA seq 291 aa AA seqDB search
MFELKGVIPALVTPMTKDYKLDLKGLCELIDFQIKSGSDSIIVGGSTGEYNLLTEDERRE
IIRVAVEYAAGRIPVIAGTGSNSTDATIRLSKYAEEVGADAVLVINPYYPNPGQNGLYEH
FKELAKSVNIPIIIYNWPAGTNIDISIETLEKLSEFDNIIGIKDTAPLEHTMLLIAHFGK
RYAITTGLEIFFLSAIQLGATGGIGVAQNIIPRQMVELYKMAMIEPEAAKELHYRLLPLY
EVLFIEPNPVPIKTALNIMGMPAGPCRPPLQPMRQENIEKLKTVLKELGLC
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaactgaagggtgtaatacctgccttggttactccaatgacgaaggattataaa
ttggatttaaaaggattgtgtgaattgatagattttcaaataaaatcagggtctgacagc
ataatagttggtggtagtacaggtgaatataatcttttgactgaggatgaacgtcgcgag
ataataagagtagcagttgagtatgctgcggggagaattcctgttatagcagggacgggt
agtaacagcacagatgctactattcgattatcaaagtatgcagaagaagttggggcagat
gcagtattagtaataaatccgtattatccaaaccctggacagaatggattgtatgaacac
tttaaagaattagcaaaatccgtaaatatacctattatcatctataattggcccgcaggt
acaaatattgatatatcaatagaaacacttgaaaaactcagcgaatttgacaatattata
ggcataaaagatacagctccgctcgaacatacaatgttacttatagcacattttgggaaa
aggtatgctattacaacaggccttgaaatatttttcttgtctgctatacaattgggggca
actggtgggataggggttgcgcaaaatataattccacggcaaatggtagaactttataaa
atggctatgatcgagccagaagctgcaaaagagctacattatcgtttattaccgttatat
gaagttttgtttattgagcctaatcccgtgcctattaagacggcattaaatattatgggt
atgccagctggtccttgcagaccccctcttcagccaatgcgtcaggaaaatatagaaaaa
cttaagactgttctaaaagagctgggtctttgctaa

DBGET integrated database retrieval system