KEGG   Thermoanaerobacter wiegelii: Thewi_0374Help
Entry
Thewi_0374        CDS       T01607                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4_16 Fer4_11 Fer4_3 Fer4_4 Fer4_15 Fer4_13 Fer4_22 Fer4_17 Fer4_8
Motif
Other DBs
NCBI-ProteinID: AEM77863
UniProt: G2MUW2
Position
400513..400893
Genome map
AA seq 126 aa AA seqDB search
MGIRIDKSLCTNCRACLLACSMKNFGICNPKLSLMDIRETENIYLEVVTCIQCKNAVCIR
VCPSKAIKRQNGIVKIDKEKCVGCGICAQYCPQSVIKVISGKAFKCELCEGAPACVQVCS
TGAISY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggggatccgaatagataaatctttgtgtacgaattgcagagcatgcttattagcatgc
tctatgaaaaattttggtatatgtaatccaaaattatcattgatggatatcagagagact
gaaaacatctatcttgaggtggttacttgtattcagtgtaaaaatgctgtatgtatcaga
gtatgtccgagtaaagcgataaaaagacaaaatggtatcgtgaaaatagacaaagaaaaa
tgtgttggttgtggaatatgtgctcaatattgcccacaaagtgtaataaaggtgatatca
ggaaaagcattcaaatgtgaattgtgtgagggcgctccagcatgtgtacaagtttgttct
acaggagcaatttcatattag

DBGET integrated database retrieval system