KEGG   Thermoanaerobacter wiegelii: Thewi_0383Help
Entry
Thewi_0383        CDS       T01607                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K05773  tungstate transport system permease protein
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi02010  ABC transporters
Module
twi_M00186  Tungstate transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Thewi_0383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:twi02000]
    Thewi_0383
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Tungstate transporter [MD:M00186] [OT]
    Thewi_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEM77871
UniProt: G2MUX0
Position
409216..409914
Genome map
AA seq 232 aa AA seqDB search
MELIWEGLKGAFKFLVHGDPEIREITLLSLRIAAWAIGISSVIGLPLGIALGVSTFRGRD
FLLTLANTGMGLPPTVVGLWVAIVLWRTGPLGGLKLIYTPTAIIIAEVILTVPIIIALVA
AAASDKKAKLHDFFLSLGLNPLQYMWLLLREIRSSVLTAIIAGFGRAISEVGAAMMVGGN
IAGETRTLTTAIVLEVSKGEFDRALAISFVLLALSFSITAFITHLQYQQNLK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttatctgggaaggcctgaaaggagcattcaagtttcttgttcatggggatcca
gaaatcagagaaattactcttctttctcttaggattgctgcgtgggctatagggataagt
tcagtcattggccttccacttgggattgcacttggagtaagcacgttccgtggcagggat
tttcttctgactttagccaataccggcatgggacttccaccgacagttgtggggctttgg
gtagctattgtgctatggcgtaccggccctttaggaggattaaagctgatttatactcct
actgccatcatcattgctgaagtaattcttaccgtgcctattattatagctttggtagct
gcagctgcgtcggataaaaaagctaaattacacgatttttttctttctttagggttgaac
cctcttcaatatatgtggcttttacttcgggaaattcgtagctcagttttaacagcaatc
attgccggttttggacgtgcaatttcggaggtaggagcagcaatgatggtaggagggaac
atcgctggggaaacccgcacgcttaccaccgctattgttcttgaagtatctaagggtgag
tttgaccgcgcgttagcgataagttttgtacttcttgccttatcgttttctattactgcc
tttattacccaccttcagtatcaacaaaacttaaagtag

DBGET integrated database retrieval system