KEGG   Thermoanaerobacter wiegelii: Thewi_0388Help
Entry
Thewi_0388        CDS       T01607                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00790  Folate biosynthesis
twi01100  Metabolic pathways
twi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thewi_0388
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Thewi_0388
Enzymes [BR:twi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     Thewi_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: AEM77876
UniProt: G2MUX5
Position
414566..415519
Genome map
AA seq 317 aa AA seqDB search
MRDRLGRNADYLRVSVTDRCNLRCIYCMPEEGIPKKDHNEILRNEEILKIIRISAELGIK
KVRFTGGEPLVRKGIENIIYETSKIKGIEDIALTTNGTKLYEMADTLKEAGLKRVNISLD
SLKKDRYRMITRLGNIDDVFRAIDKSLSIGLEPVKINTVVIKSINDDEIFDFVKLADENP
LHIRFIEIMPIGEGAKFKDNYISSDDLISSIPGLTPVETEPGNTARVFKRKGAKGTVGFI
APLSCKFCSSCNRIRLTATGTIKPCLHSKYEVDIKSFLNDEDKIRAMLEHAILSKPAGHN
LEKEISQSQKMMFQIGG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagataggttaggaagaaatgctgattatttaagagtttctgttacggatagatgt
aacttaaggtgcatttattgtatgccggaggagggaatacccaaaaaagatcataatgag
attctaaggaacgaagagattttaaaaataattagaatttcagccgaacttggcattaaa
aaggtaaggtttacaggaggcgagccacttgtaaggaagggaattgagaacataatttat
gaaacatcaaaaataaaaggcattgaagacattgcacttacaactaatggaacaaaactt
tatgaaatggcagatactttaaaagaagcaggacttaaaagagttaacataagccttgat
agtcttaaaaaagatcgataccgtatgattacaaggcttgggaatattgatgatgtattt
agggctattgacaaaagtttatctattggacttgaacctgtaaaaattaatacggttgta
ataaaaagtataaatgacgatgaaatttttgattttgtaaaacttgccgatgaaaacccg
cttcatatcagatttattgaaataatgccgataggtgaaggagcaaaattcaaagataac
tatatatcgtcggatgatttaataagtagcattcccggactgactccggttgaaacagaa
ccgggtaacactgcaagggtttttaaaagaaaaggagcaaagggaacggttggttttatt
gcacctttgtcatgtaaattttgttcaagttgtaataggattagacttactgcaactgga
actataaaaccttgtctgcattcaaaatatgaagtagatattaaaagttttttaaatgat
gaagacaagataagagcaatgctggaacatgcaatcttaagtaagccggcagggcataat
cttgaaaaggaaataagccagagtcaaaaaatgatgtttcaaatagggggatag

DBGET integrated database retrieval system