KEGG   Thermoanaerobacter wiegelii: Thewi_0389Help
Entry
Thewi_0389        CDS       T01607                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein C
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00790  Folate biosynthesis
twi01100  Metabolic pathways
twi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thewi_0389
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Thewi_0389
Enzymes [BR:twi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     Thewi_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaC DNA_pol3_beta PPP1R32
Motif
Other DBs
NCBI-ProteinID: AEM77877
UniProt: G2MUX6
Position
415523..415999
Genome map
AA seq 158 aa AA seqDB search
MNLTHINEEGRARMVDVSDKDETKREAVAIGSIYMKSETLRRIHEGTIKKGDVLAVAQVA
GIMAAKNTSHMIPMCHPIMITGCDISFSLDFENSKIDIKAVVKTVGQTGVEMEALTAVTV
AALTIYDMCKAIDRDMVISEIMLVKKSGGKSGLYEREV
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaacacacattaatgaagaaggtagagcaaggatggttgatgtcagcgataaa
gatgagacaaaaagggaagctgttgcaataggaagcatttatatgaaaagtgaaacttta
agaagaatacatgaaggaactattaaaaaaggagatgtcctagcagttgcacaggttgct
ggtattatggctgcgaaaaatacatctcatatgattccaatgtgtcatcctatcatgata
accgggtgtgatattagttttagtttggattttgaaaattcaaagattgacattaaagcg
gtagttaaaactgttggacaaacaggggttgagatggaggcattgactgcagttacggtt
gcagctcttacaatttatgatatgtgtaaagcaatagatagagacatggttataagcgaa
ataatgcttgtgaaaaaaagtggtggaaaatcaggcctttatgagagggaggtttaa

DBGET integrated database retrieval system