KEGG   Thermoanaerobacter wiegelii: Thewi_0393Help
Entry
Thewi_0393        CDS       T01607                                 

Definition
(GenBank) PTS system, mannitol-specific IIC subunit
  KO
K02799  PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  PTS system, mannitol-specific IIC component
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00051  Fructose and mannose metabolism
twi02060  Phosphotransferase system (PTS)
Module
twi_M00274  PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thewi_0393
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Thewi_0393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:twi02000]
    Thewi_0393
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     Thewi_0393
Transporters [BR:twi02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    Thewi_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AEM77879
UniProt: G2MUX8
Position
417906..419351
Genome map
AA seq 481 aa AA seqDB search
MQNTNALITGGGSVKAKLQRLGGFLAGMVIPNIGAFIAWGLITAFFIPTGWIPNEHLAKL
VGPMITYLLPILIGYTGGKLVYDVRGGVVGAIATAGIIIGSSIPMFLGAMLMGPLGGYVI
KKFDELVEGKIPAGFEMLVNNFSAGILGGLLAILAFLFIEPVVNGISVGLGAAAQWVTNK
GLLPLIAIFIEPGKILFLNNAINHGILAPLGVAQVKELGKSIFFLLETNPGPGLGVLLAY
WFFGKGDAKQSAPGAIIIHFFGGIHEIYFPYVLMNPSLLLAVIGGGMAADATFVLTKAGL
VATPSPGSIFAEIAMSPKGGLLPVLAGITVGAVVSFLIASVIVKRASEESMSAESMTFAR
SIVSGLKAQSKGQKVEEIKPNVQKIDGMPKMIVFACDAGMGSSAMGETILKKKLKEAGLN
ITVKHSAVNQIPKEADIVFTQENLAERASQVVPNAKIVTVKNFLDNTAYDEFVKSLAENN
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacactaatgctctcataactggtggcggaagtgtaaaggcgaagttgcaaagg
cttggtggcttcttggctggcatggtaatacctaatattggtgctttcatagcatgggga
cttattactgctttctttattccgacagggtggattccaaatgaacatttggctaaactt
gttggacctatgataacttatcttttaccaattttaatcggttatacaggtggaaaactt
gtatacgatgtaagaggtggagtagttggtgctattgcaacagcaggtattataatcggt
tcatctataccgatgtttcttggtgccatgctgatgggtcctttaggaggttatgtcatt
aaaaaatttgacgagcttgtagagggaaaaatcccagcaggttttgaaatgcttgtcaac
aatttttcagcaggtattttaggtggtttattagcaattttagcatttcttttcattgaa
ccagtggtaaatggaatttcagtaggattaggtgcagcagctcaatgggtgacaaacaaa
ggcttattacctttaatagcgatttttatagaaccgggtaaaattttatttttaaataat
gctattaaccacggtatattggctcctcttggagtagcacaagttaaagaacttggaaag
tcaatattcttcttgctggaaacaaatccaggtccgggattgggagttttactggcatac
tggttctttggaaaaggtgatgcaaaacaatcagctccaggtgctatcataatacacttc
tttggcggaatacatgaaatatatttcccctatgttttaatgaatccatcactgcttttg
gcagttataggcggtggaatggctgcagacgcgacatttgttttgacaaaagcaggtttg
gtagctacgccttcacctggtagtatatttgcagagatagctatgtcaccaaaaggcgga
ttacttcctgtacttgcaggtattacagttggagctgttgtttccttcctcatagcttct
gtcattgtaaaaagggcaagcgaagaaagcatgagtgccgaaagcatgacttttgctcgc
tcgatcgttagtggacttaaagcgcaaagcaaaggacaaaaagttgaagaaataaagcca
aatgtacaaaaaatagatggcatgcctaaaatgattgtttttgcttgcgatgctggtatg
ggttcgtcagcaatgggagaaactattttaaagaagaagttaaaggaagcaggacttaat
attacagttaagcattcagctgtaaatcaaataccaaaagaagcggatattgtatttacc
caagaaaatctcgcagaaagggcttctcaagttgtaccaaatgcgaaaatcgttacagta
aaaaactttttagataatactgcttacgatgaatttgtaaaaagtcttgcggaaaataat
aaatag

DBGET integrated database retrieval system