KEGG   Thermoanaerobacter wiegelii: Thewi_0397Help
Entry
Thewi_0397        CDS       T01607                                 

Definition
(GenBank) 5'-Nucleotidase domain-containing protein
  KO
K01119  2',3'-cyclic-nucleotide 2'-phosphodiesterase / 3'-nucleotidase [EC:3.1.4.16 3.1.3.6]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00230  Purine metabolism
twi00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Thewi_0397
   00240 Pyrimidine metabolism
    Thewi_0397
Enzymes [BR:twi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.6  3'-nucleotidase
     Thewi_0397
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.16  2',3'-cyclic-nucleotide 2'-phosphodiesterase
     Thewi_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C SH3_3 Metallophos PGA_cap SH3_4 YmdB SH3_2
Motif
Other DBs
NCBI-ProteinID: AEM77883
UniProt: G2MUY2
Position
423388..427068
Genome map
AA seq 1226 aa AA seqDB search
MFRSRSRILAIFVAAIMVFSMFFSAVPQIVFAATSKTFDFIEVTDFHGYLQNDGKLSDGT
IYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLKGQPVIDMMKNIGFDAI
TLGNHEYDWGINSVIDTQNATLKDSAIPVLAANVYDKTTGKPVSYVKPYVIIERDGVKIG
IIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQGVQIVVVLAHMGAYQDKSG
NATGNLIDFAKQVKGVDAIFGGHTHSIVTTRVNGIPVGVAYYYGRGFIDLKITLNDDGTV
TTGDMQYIDITGLYSTQNPVVDPEVQAIVDKAVQDVGPIFNEVIGQAAIDLTRTQSAEPY
GDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMKMTG
AQVKTILEQAVQDGGKGIQVAGLTFKYDPSKPSMQRVFDMRKSDGTPILMDKTYLVATNN
FMGTGGDGFKGFTDPDVAKTYVDTYKLVRDAFIDAVKAQKTVTSKIDNRIVPAKMSDATI
TVVATSDIHGNIYPWDYNTAKSANQGLAKVSTYVKQVRAQYPYVVLVDNGDTIQGTPLSY
YYDKIDTTTEYPLAKVMGAMKYDTWTLGNHEYNYGLDVLNRIINDMRNEGIHVLSANTYK
GDGTNFVDPYYIKTFDTPQGPVKVGILGLTTKTIPSWEDKDHYAGLHFNDLVEEANKWVP
KLREAGADIIIATIHSGEESPTDVIPENQVKAVATQVNGIDAIVAGHTHAIISQHTYKNP
AGETVIVTEPGKWGQYVSQINFNISKNADGKWVIDSKWSATIKMDDSVQADSDILNLAQP
YQDATLKYIGTKIGVATGDFLGTEQTVKETAIMDLINKVQKYYAKTDLSIAAPLSSSAKI
LKGDITIQDIMGVYVYENYLYGIKMTGKQLKDWLEWSARYYKQVSSPNDPITKDPTLNIP
DYNLDQLYGASYVIDLTQPAGHRIKNLKVNGKLVKDDDVFTVAINNYRFNGGGGFMQAAG
ITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTITPTVENYWYVSTTPVAEEAPSPVTQP
TPATTPQPQPAPQPVYNYGIVTASALNVRAGASTSSKIIGVLPAGKVVTLLEEVNGWYKI
DYNGKTGYIYGKYVAATPNPSNVTVLKAVKVTAKSGLNVRVGNSINAKKIGAVPYGTELK
VVGEYNGWYQIQYNGGFGYVYAKYTK
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggtcaaggtcaaggatacttgcaatatttgttgcagcaataatggtatttagt
atgtttttctctgcggtaccgcagatagtctttgctgcaacgtcaaaaacatttgacttt
atagaagtcaccgattttcacggttatttacaaaacgatggtaaattaagtgatgggaca
atttataagcagcaaatagcaggtgttttggcaaaacaaattaaagacataaaagctcaa
aatcctgacagaactgtaattttatctggcggagatatgttccaaggaacgccgctttcc
aacgtcttaaaaggacagccagttattgacatgatgaaaaacattggctttgacgcaata
actcttgggaatcacgaatatgactggggtattaattcagtaattgatacgcaaaatgct
acacttaaagattcagcaattcccgttcttgcagcaaatgtgtatgataaaacaactggg
aagcctgtgagttatgtaaagccctatgtaattattgaaagagatggagtaaaaatcggc
ataattggcatcgtagacaataaagaattcccaaatataataatgcctgcatatatacaa
aatgttgaatttaaagatcctgttccaattgtaaatgacttagcgcagcagttaagacaa
caaggtgtgcaaattgttgttgtactggcacatatgggtgcatatcaagataagtcaggt
aatgcaacaggcaatcttatagactttgcaaaacaagttaaaggtgtagatgctatattt
ggtggacatacacattcaattgtcactacaagagtaaatggaattcctgtaggggttgct
tactattatggcagaggattcatcgatttaaagataacattaaatgatgatggcacagtt
acaacaggcgatatgcaatacattgatattacaggtttgtattctacacaaaatcctgta
gtggatcctgaagtacaagccattgtcgataaagctgttcaagatgtaggaccaatattt
aacgaagtgataggtcaagctgcaatagatttgacaaggactcaaagtgctgagccttat
ggagattctctcttaggcaattgggcagcacaagtgacaaaggatgcagttggagcagat
tttggatttgccaataatggtgggcttaggatagatattccaaaaggcgatataactgtt
ggaatgatgtatcaattgatgccttttgacaacacaatagttacaatgaaaatgacaggg
gcgcaagtaaaaactatacttgaacaggctgtacaagatggtggcaagggtatacaggtt
gcgggacttactttcaagtatgatccatctaagccttcaatgcaaagagtatttgatatg
agaaagtccgacggaacgccaatactcatggataaaacttatcttgttgcgacaaacaac
tttatgggcactggcggagatggctttaaaggttttacagaccctgatgttgcaaaaact
tatgttgatacatataagcttgtaagagatgcattcatagatgcagttaaagcccaaaag
acagttacttcgaaaatagataatagaattgtaccagctaaaatgagcgatgcgacaata
acagtagttgctacgtcagatatacatggcaatatatacccatgggactacaatactgca
aaatcagctaaccaaggtcttgcaaaggtatctacttatgtaaaacaggtaagagcgcaa
tatccttatgtggtattagtagacaatggagacacaatacaaggaacaccactttcttac
tattatgacaagatagataccactacagaatatccattagcaaaagtaatgggagcaatg
aaatatgacacctggacattgggcaaccatgaatacaattatgggcttgacgttttaaac
aggattataaatgatatgagaaatgaaggcatacatgtactttcagcaaatacttacaaa
ggtgacggaacaaactttgttgacccttactatattaagacatttgatacgccacaagga
cctgtaaaagtaggtatattaggccttacgactaaaactataccatcatgggaagacaaa
gaccactatgcaggattacacttcaatgaccttgtagaggaagcaaataagtgggtaccc
aaattaagagaagcaggagcagatataataattgctacaattcactctggtgaagaatca
ccgacagatgtaatacctgaaaatcaagttaaagccgttgcaactcaagtaaatggtatt
gatgcaatagttgcaggacatacacatgctattatatcacagcacacatataagaacccg
gcaggcgaaacagttatagtgacagaaccaggtaaatggggacaatatgtatcacagata
aactttaatataagcaaaaatgctgatggaaaatgggtaatagatagcaaatggagtgca
actataaaaatggatgattctgtacaagcagattcagatattttaaaccttgcacaacca
tatcaagatgcaacacttaaatatataggaacaaaaatcggtgttgcaacaggtgacttc
ttaggtactgaacagacagtaaaagagacagctataatggacctcatcaataaagttcaa
aaatattatgcaaaaactgatctatcaattgctgcaccacttagcagttcagcaaagata
ttgaaaggcgatataacaattcaagacattatgggtgtatatgtatatgaaaattacttg
tatggaataaagatgactgggaaacagttaaaagactggttggaatggtcagcaaggtat
tacaaacaagtctcctcgccaaatgatcctataacaaaagatcctactttgaatatacct
gattacaatcttgatcaattgtacggtgcaagctatgtaatagatttaacacaaccagca
ggacataggattaaaaaccttaaagtaaatggtaaacttgtcaaagacgatgatgtattc
acagtagcaataaataactacaggttcaatggtggcggcggatttatgcaagctgctgga
ataacaaatccagaaattgtatttgattccgcaaaagcttatggcgacgacggacaggta
aggaatttgatgatcagatatattcaagagcatggtacaattacaccaaccgtcgagaat
tactggtatgtatcaactactcctgtggcagaagaagcaccatcaccagtaacacaacca
acacctgctacaactccacaaccacaacctgcaccacaacctgtatacaactatggcatt
gtaactgcatcagcgcttaatgtgagggcaggtgcaagcacttcaagcaaaattatagga
gtacttcctgccggaaaagttgtgacattgcttgaagaagtcaacggatggtacaagatt
gactacaatggcaagacaggatacatctatggtaaatacgttgctgcaacgcccaatccg
tcaaatgtaactgttttgaaagctgtaaaagtcactgctaagagcgggttaaatgtaaga
gtagggaattctataaatgcaaagaagataggagcagtaccatatggtacagaactaaaa
gtagttggagaatataatggatggtatcagatacagtataatggcggatttggatatgta
tacgcaaaatatacaaaataa

DBGET integrated database retrieval system