KEGG   Thermoanaerobacter wiegelii: Thewi_0399Help
Entry
Thewi_0399        CDS       T01607                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
twi  Thermoanaerobacter wiegelii
Brite
KEGG Orthology (KO) [BR:twi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Thewi_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE FUSC_2
Motif
Other DBs
NCBI-ProteinID: AEM77885
UniProt: G2MUY4
Position
428445..429206
Genome map
AA seq 253 aa AA seqDB search
MSIEYIVALCGIGFAAAFIDSIAGGGGIISLPGLLVLGVPPAFALGTNKFAASCASFTSS
LTFIKYRVYDGDLLKYLVFGTLLGAILGVKTVLLLDSSQLRIIIIILMMFVAIYTLFVKN
IGNENKFEGVNKKTIAIGLIISIILGFYDGFFGPGTGSFYIFLFLTLLNYDFKISAGNGK
ILNFVSNITSLIMFALHGKILYSIAIPMALAMILGARLGTKLAIKNGARLIRPILISVTL
LYAVKMIFDITNH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaattgaatatattgtagcactttgcggtataggatttgcagctgcttttattgat
tctatagcgggtggaggcggtataataagccttccagggcttttagtacttggagtacct
ccagcttttgcgcttggaactaacaaatttgctgcttcttgtgcttcttttactagttct
ttaacttttataaagtatagagtgtatgatggagatttgttaaaatacttggtatttggg
actttattaggtgcaattcttggagtcaaaactgtacttttgttagatagctcgcaatta
aggataattataattattctaatgatgtttgttgcaatatataccttgtttgttaaaaat
ataggcaatgaaaacaaatttgaaggcgttaataaaaagactattgcaataggccttata
atttctataattcttggcttttatgatggcttttttggaccgggaacaggttcattttac
atttttttattcttaacacttttgaattatgattttaaaataagtgcaggaaatgggaaa
atactgaattttgtaagcaatataacttcactaattatgtttgcgttacatggtaagata
ttgtattctattgcaattcccatggcgttagcaatgatactgggggcaagattggggaca
aagctggctataaaaaatggagctcggcttataaggcctatattgatttctgtcactttg
ttgtatgcagtgaaaatgatttttgatataacaaatcattaa

DBGET integrated database retrieval system